DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and Dnajc14

DIOPT Version :10

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_083149.3 Gene:Dnajc14 / 74330 MGIID:1921580 Length:703 Species:Mus musculus


Alignment Length:63 Identity:22/63 - (34%)
Similarity:40/63 - (63%) Gaps:3/63 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 YKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQFD 460
            :.:|||:.:||..|:.||||:.|...|||.   .....||:.|..:.||.:::::||:|::::
Mouse   446 FHVLGVEATASDTELKKAYRQLAVMVHPDK---NHHPRAEEAFKILRAAWDIVSNPERRKEYE 505

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR repeat 43..71 CDD:276809
LapB 47..284 CDD:442196
TPR repeat 76..106 CDD:276809
TPR repeat 111..139 CDD:276809
TPR repeat 190..220 CDD:276809
LapB 196..>378 CDD:442196
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR repeat 341..371 CDD:276809