DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and DNAJC7

DIOPT Version :9

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_003306.3 Gene:DNAJC7 / 7266 HGNCID:12392 Length:494 Species:Homo sapiens


Alignment Length:467 Identity:117/467 - (25%)
Similarity:204/467 - (43%) Gaps:25/467 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DIENHLELGKEFLARGQLSDALTHYHAAVEGDANNYLTLFKRGTVYLALGKTRFAVQDFSRVLEL 106
            :.|...|.|..:.|:...::|..:|..|::....|......|....:.||:.|.|:.|..:.:.|
Human    27 EAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRL 91

  Fly   107 KPDFMAARIQRGVVHMKSGEYEQAIQDFDQVLQEEPNNGLVLEHYSRLAPAQEQWVLVQQLIQYS 171
            ...|:...::.|..|:..|....|.:.|.:.|:.:..|....:.:.......|...:.:...:..
Human    92 DDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKR 156

  Fly   172 DHQNAIPMITQLLEISPWAVPFRQARSDAYIAINDPLLAIADLRQVNRLTQDSTEGHYKIAQLLY 236
            |.:..:..:.:.||.:|....|:..:::....:.....|.:....:.|:...:.:..|.....||
Human   157 DFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLY 221

  Fly   237 TIGHATNALKEIRECLKFDPEH-KLCFPFYK-KLRKVEKQLVNAEQAREEKHFAECIAAGEAVLR 299
            .......|::...:.|:..|:| |.|..... |..|.:|:  :..:|.:|.::..........|.
Human   222 YEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKE--DGNKAFKEGNYKLAYELYTEALG 284

  Fly   300 NEPEETMIRYEGHKVLCTCYTGDEQFGK---ALQQCKEALDIMKDAQV--YCDRADALLGTEMYD 359
            .:|....   ...|:.|...|.:.:..|   |::.|..|:. :.|..:  |..||...:.||.|:
Human   285 IDPNNIK---TNAKLYCNRGTVNSKLRKLDDAIEDCTNAVK-LDDTYIKAYLRRAQCYMDTEQYE 345

  Fly   360 DAIHSFQAALDLEESNTRAKEGIQRAKKLQ---KQSERRDYYKILGVKRSASKQEIVKAYRKAAQ 421
            :|:..::.....|    :.||..|..|..|   |:|:|:||||||||.::||:.||.|||||.|.
Human   346 EAVRDYEKVYQTE----KTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRAL 406

  Fly   422 KWHPDNFRD---EEKKVAEKKFIDIAAAKEVLTDPEKRRQFDNGEDPLDPESNQRGGFHGEHPFG 483
            ..|||....   |.:|..||||.::..|..:|:||:|:.::|:|:| ||.|....|.|...:.|.
Human   407 MHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQD-LDEEGMNMGDFDPNNIFK 470

  Fly   484 HFQHGSPFQFKF 495
            .| .|.|..|.|
Human   471 AF-FGGPGGFSF 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR_11 42..108 CDD:290150 15/65 (23%)
TPR repeat 43..71 CDD:276809 7/27 (26%)
TPR repeat 76..106 CDD:276809 7/29 (24%)
TPR_11 78..142 CDD:290150 14/63 (22%)
TPR repeat 111..139 CDD:276809 5/27 (19%)
TPR_1 113..144 CDD:278916 6/30 (20%)
TPR_19 167..234 CDD:291240 8/66 (12%)
TPR repeat 190..220 CDD:276809 2/29 (7%)
TPR repeat 225..253 CDD:276809 4/27 (15%)
TPR repeat 309..337 CDD:276809 7/30 (23%)
TPR_11 312..373 CDD:290150 15/65 (23%)
TPR repeat 341..371 CDD:276809 8/31 (26%)
TPR repeat 376..399 CDD:276809 10/25 (40%)
DnaJ 395..>485 CDD:223560 41/92 (45%)
DnaJ 396..460 CDD:278647 32/66 (48%)
DNAJC7NP_003306.3 3a0801s09 19..>353 CDD:273380 62/331 (19%)
TPR 1 28..61 7/32 (22%)
TPR repeat 28..56 CDD:276809 7/27 (26%)
TPR repeat 61..91 CDD:276809 7/29 (24%)
TPR 2 62..95 7/32 (22%)
TPR 3 96..129 6/32 (19%)
TPR repeat 96..124 CDD:276809 5/27 (19%)
TPR 4 142..175 5/32 (16%)
TPR repeat 145..170 CDD:276809 1/24 (4%)
TPR repeat 175..205 CDD:276809 2/29 (7%)
TPR 5 177..209 3/31 (10%)
TPR 6 210..243 6/32 (19%)
TPR repeat 210..238 CDD:276809 4/27 (15%)
PLN03088 253..>353 CDD:215568 22/105 (21%)
TPR 7 256..289 6/34 (18%)
TPR repeat 257..284 CDD:276809 4/28 (14%)
TPR repeat 289..323 CDD:276809 7/37 (19%)
TPR 8 294..327 8/33 (24%)
TPR 9 328..361 8/36 (22%)
TPR repeat 328..356 CDD:276809 7/27 (26%)
DnaJ 380..>469 CDD:223560 40/89 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53711
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R325
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.