powered by:
Protein Alignment P58IPK and Dnajc30
DIOPT Version :9
Sequence 1: | NP_649916.1 |
Gene: | P58IPK / 41161 |
FlyBaseID: | FBgn0037718 |
Length: | 498 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_079638.2 |
Gene: | Dnajc30 / 66114 |
MGIID: | 1913364 |
Length: | 219 |
Species: | Mus musculus |
Alignment Length: | 69 |
Identity: | 22/69 - (31%) |
Similarity: | 38/69 - (55%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 394 RRDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQ 458
|...|::|||..:|::.:|..||.:.:..:||| |:.....|.::|..::.|..||.....||:
Mouse 40 RTALYELLGVPSTATQAQIKAAYYRQSFLYHPD--RNPGSAEAAERFTRVSEAYLVLGSTILRRK 102
Fly 459 FDNG 462
:|.|
Mouse 103 YDRG 106
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167847164 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.