powered by:
Protein Alignment P58IPK and Dnajc12
DIOPT Version :9
Sequence 1: | NP_649916.1 |
Gene: | P58IPK / 41161 |
FlyBaseID: | FBgn0037718 |
Length: | 498 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001029204.1 |
Gene: | Dnajc12 / 619393 |
RGDID: | 1591898 |
Length: | 198 |
Species: | Rattus norvegicus |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 38/66 - (57%) |
Gaps: | 2/66 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 396 DYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQFD 460
|||.:||....:|.::|:..::..|.:.|||...:..|.| :.|..:..|||:|::.|.|.::|
Rat 14 DYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENSKAV--ETFQKLQKAKEILSNAESRARYD 76
Fly 461 N 461
:
Rat 77 H 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166350672 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.