DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and Dnajb12

DIOPT Version :9

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001361685.1 Gene:Dnajb12 / 56709 MGIID:1931881 Length:378 Species:Mus musculus


Alignment Length:118 Identity:44/118 - (37%)
Similarity:63/118 - (53%) Gaps:14/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 EESNTRAKEGIQRAKKLQKQSERRDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVA 436
            |.:.....|.:...|:::   :.:|||:||||.||||.:::.|||||.|.|:|||.   .....|
Mouse    90 ESAKGYTS
EQVAAVKRVK---QCKDYYEILGVSRSASDEDLKKAYRKLALKFHPDK---NHAPGA 148

  Fly   437 EKKFIDIAAAKEVLTDPEKRRQFDN-GEDPLDPESNQRGGFHGEHPFGHFQHG 488
            .:.|..|..|..||::||||:|:|. |:|      ..:...|| |..|.|..|
Mouse   149 TEAFKAIGTAYAVLSNPEKRKQYDQFGDD------KSQAARHG-HSHGDFHRG 194

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR_11 42..108 CDD:290150
TPR repeat 43..71 CDD:276809
TPR repeat 76..106 CDD:276809
TPR_11 78..142 CDD:290150
TPR repeat 111..139 CDD:276809
TPR_1 113..144 CDD:278916
TPR_19 167..234 CDD:291240
TPR repeat 190..220 CDD:276809
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809