DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and dnaja2

DIOPT Version :9

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001004807.1 Gene:dnaja2 / 448048 XenbaseID:XB-GENE-998337 Length:410 Species:Xenopus tropicalis


Alignment Length:97 Identity:40/97 - (41%)
Similarity:53/97 - (54%) Gaps:9/97 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 YKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQFDN- 461
            |.||||...||:.::.|||||.|:::|||     :...|..||.:|:.|.|||::||||..:|. 
 Frog    10 YDILGVAPGASENDLKKAYRKLAKEYHPD-----KNPNAGDKFKEISFAYEVLSNPEKRELYDRY 69

  Fly   462 GEDPLDPESNQRGGFHGEHPFGHFQHGSPFQF 493
            ||..|...|   ||...:..|.|...|..|.|
 Frog    70 GEQGLREGS---GGSGMDDIFSHIFGGGLFGF 98

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR_11 42..108 CDD:290150
TPR repeat 43..71 CDD:276809
TPR repeat 76..106 CDD:276809
TPR_11 78..142 CDD:290150
TPR repeat 111..139 CDD:276809
TPR_1 113..144 CDD:278916
TPR_19 167..234 CDD:291240
TPR repeat 190..220 CDD:276809
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR_11 312..373 CDD:290150
TPR repeat 341..371 CDD:276809