DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and Droj2

DIOPT Version :10

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster


Alignment Length:99 Identity:39/99 - (39%)
Similarity:56/99 - (56%) Gaps:13/99 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 YYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQFDN 461
            ||.|||||.:|:..|:.|||||.|.|:|||...:|     .:||..|:.|.|||:|.:||:.:|.
  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKNPNE-----GEKFKAISQAYEVLSDADKRQVYDE 66

  Fly   462 GEDPLDPESNQRGGFHGEHPFGHFQHGSPFQFKF 495
            |.:    .:.::||...    |.|::...|..||
  Fly    67 GGE----AAIKKGGADS----GDFRNPMDFFEKF 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR repeat 43..71 CDD:276809
LapB 47..284 CDD:442196
TPR repeat 76..106 CDD:276809
TPR repeat 111..139 CDD:276809
TPR repeat 190..220 CDD:276809
LapB 196..>378 CDD:442196
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR repeat 341..371 CDD:276809
TPR repeat 376..399 CDD:276809 1/1 (100%)
PRK14278 395..>485 CDD:237654 35/87 (40%)
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 39/99 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.