DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment P58IPK and Dnajc16

DIOPT Version :9

Sequence 1:	NP_649916.1	Gene:	P58IPK / 41161	FlyBaseID:	FBgn0037718	Length:	498	Species:	Drosophila melanogaster
Sequence 2:	NP_001014216.1	Gene:	Dnajc16 / 362652	RGDID:	1359395	Length:	771	Species:	Rattus norvegicus

Alignment Length:	106	Identity:	43/106 - (40%)
Similarity:	62/106 - (58%)	Gaps:	9/106 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   396 DYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQFD 460
            |.|::|||.|:||:.:|.|||:|.|::||||..:|..   ||.|||.|:.|.|:|::.|||..:|
  Rat    29 DPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPG---AEDKFIQISKAYEILSNEEKRTNYD 90

  Fly   461 NGEDPLDPESNQRGGFHGEHPFGHFQHGSPFQ---FKFHFN 498
            :..|..:.:..|:   ..|:.|.||.....|.   |.|.||
  Rat    91 HYGDAGENQGYQQ---QREYRFRHFHENFYFDESFFHFPFN 128

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
P58IPK	NP_649916.1	TPR_11	42..108	CDD:290150
		TPR repeat	43..71	CDD:276809
		TPR repeat	76..106	CDD:276809
		TPR_11	78..142	CDD:290150
		TPR repeat	111..139	CDD:276809
		TPR_1	113..144	CDD:278916
		TPR_19	167..234	CDD:291240
		TPR repeat	190..220	CDD:276809
		TPR repeat	225..253	CDD:276809
		TPR repeat	309..337	CDD:276809
		TPR_11	312..373	CDD:290150
		TPR repeat	341..371	CDD:276809
		TPR repeat	376..399	CDD:276809	1/2 (50%)
		DnaJ	395..>485	CDD:223560	36/88 (41%)
		DnaJ	396..460	CDD:278647	31/63 (49%)
Dnajc16	NP_001014216.1	DnaJ	29..90	CDD:278647	31/63 (49%)
		TRX_DnaJ	133..242	CDD:239261
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	559..590
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166350678
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.930