DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and BBS4

DIOPT Version :10

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster


Alignment Length:402 Identity:96/402 - (23%)
Similarity:147/402 - (36%) Gaps:94/402 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLELFLEGAESTASPADIENHL--ELGKEFL---------ARGQLSDALTHYHAAVEGDANNYLT 79
            ||.::....|.|.....||..|  .|..|:|         ..|...:||.|...:.|.:..|..|
  Fly    39 LLHIYFTRREFTRCRRLIERELNRHLNPEYLYFVQGLIDREEGNHIEALRHLQKSAELNPRNIET 103

  Fly    80 LFKRG-TVYL------ALGKTRFAVQDFSR--------VLELKPDFMAARIQRGVVHMKSGE--- 126
            ..:.| |:|:      |||..|.|.|..||        :.||.......:.|:.|...:..|   
  Fly   104 YKEIGRTLYIMGRFSQALGVFREAEQRSSRQDHEIYHYLGELLYRAATTQSQKDVASQQQDEART 168

  Fly   127 -YEQAIQDFDQVLQEEPNNGLVLEHYSRLAPAQEQWVLVQQLIQYSDHQNAIPMITQLLEISPWA 190
             :|.|:|           :|..||.|.|||.      |.::..||   |.||.::...|.::|..
  Fly   169 YFELAVQ-----------SGRKLESYVRLAE------LYRKDKQY---QKAIEILENCLHLTPEN 213

  Fly   191 VPFRQARSDAYIAINDPLLA---IADLRQVNRLTQDSTEGHYKIAQLLYTIGHATNALKEIRECL 252
            .......|..|:.||:...|   :|::..:.|  :.|.:|......:|.:......||.:..:..
  Fly   214 SEVLIEISVLYLKINETQKAHDRLAEVVSIER--KCSPKGLLAFGAILQSRNDIDGALSKYSQIA 276

  Fly   253 KFDPEHK-------LCFPFYKKLRKVEKQLVNAEQAREEKHFAECIAAGEAVLRNEPEETMIRYE 310
            ..:||..       ||  |:||                 :.|...|::    ||.....:.:.|.
  Fly   277 NAEPEIAELWNNIGLC--FFKK-----------------QKFIVAISS----LRKSVWLSPLNYN 318

  Fly   311 GHKVLCTCYTGDEQFGKALQQCKEALDIMKD-AQVYCDRADALLG--TEMYDDAIHSFQAALDLE 372
            ....|...|...||:..|......|:::.|| |:.|     .|||  ....||..::| .||:..
  Fly   319 ALYNLSLIYIASEQYASAFHTLAAAINLRKDNAECY-----MLLGLCLRKLDDMENAF-VALERA 377

  Fly   373 ESNTRAKEGIQR 384
            .|....::|..|
  Fly   378 SSMATGQQGAGR 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR repeat 43..71 CDD:276809 10/38 (26%)
LapB 47..284 CDD:442196 64/276 (23%)
TPR repeat 76..106 CDD:276809 13/44 (30%)
TPR repeat 111..139 CDD:276809 6/31 (19%)
TPR repeat 190..220 CDD:276809 6/32 (19%)
LapB 196..>378 CDD:442196 43/194 (22%)
TPR repeat 225..253 CDD:276809 4/27 (15%)
TPR repeat 309..337 CDD:276809 7/27 (26%)
TPR repeat 341..371 CDD:276809 11/32 (34%)
TPR repeat 376..399 CDD:276809 2/9 (22%)
PRK14278 395..>485 CDD:237654
BBS4NP_610636.1 TPR repeat 68..95 CDD:276809 5/26 (19%)
LapB 70..347 CDD:442196 71/321 (22%)
TPR repeat 100..130 CDD:276809 10/29 (34%)
TPR repeat 136..175 CDD:276809 7/38 (18%)
TPR repeat 179..209 CDD:276809 13/38 (34%)
TPR repeat 214..242 CDD:276809 6/27 (22%)
TPR repeat 249..277 CDD:276809 4/27 (15%)
BepA 281..423 CDD:443813 32/138 (23%)
TPR repeat 283..311 CDD:276809 9/50 (18%)
TPR repeat 316..346 CDD:276809 7/29 (24%)
TPR repeat 351..377 CDD:276809 10/31 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.