DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and CG7556

DIOPT Version :10

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_573354.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster


Alignment Length:66 Identity:19/66 - (28%)
Similarity:40/66 - (60%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 RDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQF 459
            |::|:.:|:.::|:..|:.:|:|..:...|||....|:..:   :|.::.:..|||.||.:|.::
  Fly    39 RNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAEDANI---QFRNLVSIYEVLKDPSRREKY 100

  Fly   460 D 460
            |
  Fly   101 D 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR repeat 43..71 CDD:276809
LapB 47..284 CDD:442196
TPR repeat 76..106 CDD:276809
TPR repeat 111..139 CDD:276809
TPR repeat 190..220 CDD:276809
LapB 196..>378 CDD:442196
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR repeat 341..371 CDD:276809
TPR repeat 376..399 CDD:276809 1/3 (33%)
PRK14278 395..>485 CDD:237654 19/66 (29%)
CG7556NP_573354.1 DnaJ 40..101 CDD:395170 17/63 (27%)
SANT 304..341 CDD:238096
SANT 400..447 CDD:238096
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.