powered by:
Protein Alignment P58IPK and CG7556
DIOPT Version :9
Sequence 1: | NP_649916.1 |
Gene: | P58IPK / 41161 |
FlyBaseID: | FBgn0037718 |
Length: | 498 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001285427.1 |
Gene: | CG7556 / 32902 |
FlyBaseID: | FBgn0030990 |
Length: | 522 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 19/66 - (28%) |
Similarity: | 40/66 - (60%) |
Gaps: | 3/66 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 395 RDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQF 459
|::|:.:|:.::|:..|:.:|:|..:...|||....|:..: :|.::.:..|||.||.:|.::
Fly 39 RNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAEDANI---QFRNLVSIYEVLKDPSRREKY 100
Fly 460 D 460
|
Fly 101 D 101
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45464386 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.