DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment P58IPK and dnajc4

DIOPT Version :9

Sequence 1:	NP_649916.1	Gene:	P58IPK / 41161	FlyBaseID:	FBgn0037718	Length:	498	Species:	Drosophila melanogaster
Sequence 2:	NP_997842.1	Gene:	dnajc4 / 324373	ZFINID:	ZDB-GENE-030131-3093	Length:	237	Species:	Danio rerio

Alignment Length:	155	Identity:	32/155 - (20%)
Similarity:	53/155 - (34%)	Gaps:	59/155 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly   307 IRYEGHKVLC-TCYTGDEQFGKALQQCKEALDIMKDAQVYCDRADALLGTEMYDDAIHSFQAALD 370
            :::|.|..|| ||:.                        ||..:..|...    .|.|..|.
Zfish     1 MQWEAHIRLCQTCFW------------------------YCRSSQRLFSL----SAAHRSQT--- 34

  Fly   371 LEESNTRAKEGIQRAKKLQKQSERRDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKV 435
                                     :||::||||..|:.::|..|:...::|.|||:  |.....
Zfish    35 -------------------------NYYELLGVKPDATLEQIKFAFFDKSKKLHPDS--DPSNPG 72

  Fly   436 AEKKFIDIAAAKEVLTDPEKRRQFD 460
            ...:|:.:..|..||:....|:.:|
Zfish    73 LHTQFVQLNEAYRVLSKEGSRQDYD 97

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
P58IPK	NP_649916.1	TPR_11	42..108	CDD:290150
		TPR repeat	43..71	CDD:276809
		TPR repeat	76..106	CDD:276809
		TPR_11	78..142	CDD:290150
		TPR repeat	111..139	CDD:276809
		TPR_1	113..144	CDD:278916
		TPR_19	167..234	CDD:291240
		TPR repeat	190..220	CDD:276809
		TPR repeat	225..253	CDD:276809
		TPR repeat	309..337	CDD:276809	6/28 (21%)
		TPR_11	312..373	CDD:290150	11/61 (18%)
		TPR repeat	341..371	CDD:276809	6/29 (21%)
		TPR repeat	376..399	CDD:276809	1/22 (5%)
		DnaJ	395..>485	CDD:223560	20/66 (30%)
		DnaJ	396..460	CDD:278647	19/63 (30%)
dnajc4	NP_997842.1	DnaJ	35..97	CDD:278647	19/63 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170592352
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.840