DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and Dnajc18

DIOPT Version :10

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001385532.1 Gene:Dnajc18 / 291677 RGDID:1310237 Length:357 Species:Rattus norvegicus


Alignment Length:132 Identity:44/132 - (33%)
Similarity:63/132 - (47%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 GIQRAKKLQKQSERRDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKV---AEKKFID 442
            |:||.||.      |:||.||||..:||.:|:.|||:|.|.|:|||      |..   |...|..
  Rat    73 GVQRIKKC------RNYYDILGVSHNASDEELKKAYKKLALKFHPD------KNCAPGATDAFKA 125

  Fly   443 IAAAKEVLTDPEKRRQFDN-GEDPLDPESNQRGGFH----------GEHPF-----GHFQHGSPF 491
            |..|..||::|:||.::|. |::.:...:.:...:|          .|..|     |||..|:..
  Rat   126 IGNAFAVLSNPDKRLRYDEYGDEQVTLTAPRARPYHYYRDVEADISPEELFNVFFGGHFPSGNIH 190

  Fly   492 QF 493
            .|
  Rat   191 MF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR repeat 43..71 CDD:276809
LapB 47..284 CDD:442196
TPR repeat 76..106 CDD:276809
TPR repeat 111..139 CDD:276809
TPR repeat 190..220 CDD:276809
LapB 196..>378 CDD:442196
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR repeat 341..371 CDD:276809
TPR repeat 376..399 CDD:276809 7/17 (41%)
PRK14278 395..>485 CDD:237654 35/108 (32%)
Dnajc18NP_001385532.1 PRK14298 81..>182 CDD:184612 34/106 (32%)
DUF1977 249..347 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.