powered by:
Protein Alignment P58IPK and C47A4.1
DIOPT Version :9
Sequence 1: | NP_649916.1 |
Gene: | P58IPK / 41161 |
FlyBaseID: | FBgn0037718 |
Length: | 498 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_502648.2 |
Gene: | C47A4.1 / 183525 |
WormBaseID: | WBGene00008122 |
Length: | 157 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 29/66 - (43%) |
Gaps: | 8/66 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 LTLFKRGTVYLALGKTRFAVQDFSRVLELKPDFMAARIQRGVVHMKSGEYEQAI--QDFDQVLQE 140
||:| |...:.||...|||:|. |...|.....:.|..:.:...|::|.. :|.|.:.:.
Worm 51 LTIF-RYIKWTALWYWRFAIQK-----EEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFER 109
Fly 141 E 141
|
Worm 110 E 110
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160164706 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.