DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and dnj-2

DIOPT Version :9

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_502126.1 Gene:dnj-2 / 178043 WormBaseID:WBGene00001020 Length:337 Species:Caenorhabditis elegans


Alignment Length:96 Identity:32/96 - (33%)
Similarity:50/96 - (52%) Gaps:21/96 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 YKILGVKRSA-SKQEIVKAYRKAAQKWHPDNFRD-EEKKVAEKKFIDIAAAKEVLTDPEKRRQFD 460
            |.:|.|.|.. .||::.||||..|:|.|||..:: |||.:||::|..||.|.|.|.|.|.:..:|
 Worm    38 YDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKTNYD 102

  Fly   461 NGEDPLDPESNQRGGFHGEHP----FGHFQH 487
                           ::.:||    :.::|:
 Worm   103 ---------------YYLDHPDQRFYNYYQY 118

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR_11 42..108 CDD:290150
TPR repeat 43..71 CDD:276809
TPR repeat 76..106 CDD:276809
TPR_11 78..142 CDD:290150
TPR repeat 111..139 CDD:276809
TPR_1 113..144 CDD:278916
TPR_19 167..234 CDD:291240
TPR repeat 190..220 CDD:276809
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR_11 312..373 CDD:290150
TPR repeat 341..371 CDD:276809