powered by:
Protein Alignment P58IPK and dnj-17
DIOPT Version :9
Sequence 1: | NP_649916.1 |
Gene: | P58IPK / 41161 |
FlyBaseID: | FBgn0037718 |
Length: | 498 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499759.2 |
Gene: | dnj-17 / 176761 |
WormBaseID: | WBGene00001035 |
Length: | 485 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 26/70 - (37%) |
Similarity: | 42/70 - (60%) |
Gaps: | 1/70 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 397 YYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQFDN 461
:|::|.|:|.|...:|.|.|||.|.|||||...|..::..: :|..:.||.:||:||.:|..:|.
Worm 4 HYEVLEVERDADDDKIKKNYRKLALKWHPDKNPDRIEECTQ-QFRLLQAAYDVLSDPREREFYDR 67
Fly 462 GEDPL 466
..:.:
Worm 68 HRESI 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160164697 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.