DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and Dnajc5

DIOPT Version :10

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_058055.1 Gene:Dnajc5 / 13002 MGIID:892995 Length:198 Species:Mus musculus


Alignment Length:78 Identity:29/78 - (37%)
Similarity:44/78 - (56%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 QRAKKLQKQSERRDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAK 447
            ||.:.|....|  ..|.:||:.::|:..:|.|:|||.|.|:|||  ::.:...|..||.:|..|.
Mouse     4 QRQRSLSTSGE--SLYHVLGLDKNATSDDIKKSYRKLALKYHPD--KNPDNPEAADKFKEINNAH 64

  Fly   448 EVLTDPEKRRQFD 460
            .:|||..||..:|
Mouse    65 AILTDATKRNIYD 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR repeat 43..71 CDD:276809
LapB 47..284 CDD:442196
TPR repeat 76..106 CDD:276809
TPR repeat 111..139 CDD:276809
TPR repeat 190..220 CDD:276809
LapB 196..>378 CDD:442196
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR repeat 341..371 CDD:276809
TPR repeat 376..399 CDD:276809 4/15 (27%)
PRK14278 395..>485 CDD:237654 25/66 (38%)
Dnajc5NP_058055.1 PRK10767 17..>80 CDD:236757 25/63 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.