DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and ZNF468

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_016882932.1 Gene:ZNF468 / 90333 HGNCID:33105 Length:541 Species:Homo sapiens


Alignment Length:461 Identity:138/461 - (29%)
Similarity:208/461 - (45%) Gaps:48/461 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 EAEEEEEEEEQQQQYDEEVEEPITDESAPPQLTISYACKFCLRPQENYQLQQLLLEHINAS---H 213
            |.|::....|.|.:.||      |:..|.|...|........:..:.:...:.:.:.:.:|   |
Human   108 EIEKDIHGFEFQWKEDE------TNGHAAPMTEIKELAGSTGQHDQRHAGNKRIKDQLGSSFHLH 166

  Fly   214 DPEQPYNCPECEARFQDAASRTVHLKSSHVEKQHACGVC------GKKYGDR--HN--LRHHVEK 268
            .||.  :..:.|.:..:...::::..||....|..|  |      ..|||:.  |:  |....|.
Human   167 LPEP--HIFQSEGKIGNQVEKSINNASSVSTSQRIC--CRPKTHISNKYGNNSLHSSLLTQKWEV 227

  Fly   269 YHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTSSR 333
            :..|..|||....|.|.....|..|...|..::|.||  ..|.::|..:|:|.||...|:|   .
Human   228 HMREKSFECIQSFKSFNCSSLLKKHQIIHLEEKQCKC--DVCGKVFNQKRYLACHRRCHTG---E 287

  Fly   334 KSEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERS 398
            |...|..|||||.|..:|..| ...|.|||||:|..|.:||:    ::.| ||||:...|..:..
Human   288 KPYKCNECGKTFGHNSSLFIH-KALHTGEKPYECEECDKVFS----RKSH-LERHKRIHTGEKPY 346

  Fly   399 ECMLCRQPFSSEPDLIHHMSAEHLQRPGAPIIAN------NKRVLQQKRERQYSG--LFQCGSCS 455
            :|.:|.:.|:....|..|..   |.....|...|      |:.....:..|.::|  .::|..|.
Human   347 KCKVCDEAFAYNSYLAKHTI---LHTGEKPYTCNECGKVFNRLSTLARHHRLHTGEKPYKCEECD 408

  Fly   456 QRFNMKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYV 520
            :.|:.||.||||..:|| .::|:.|..|.|.|.|..:::.|.:.|..|||..|.||.|||.....
Human   409 KVFSRKSHLERHRRIHS-GEKPYKCEECCKVFSRKSNLERHRRIHTGEKPYKCKVCDKAFQRDSH 472

  Fly   521 LTQHRLSHEVLEKNFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDLCQERFVTHIKLKTHMQKA 585
            |.||:..| ..||.:|||.||:.:....||.:|:|.|||:..|||:.|.:.|.....|..| .:.
Human   473 LAQHQRVH-TGEKPYKCNECGKTFGQTSSLIIHRRLHTGEKPYKCNECGKTFSQMSSLVYH-HRL 535

  Fly   586 HAASQP 591
            |:..:|
Human   536 HSGEKP 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 95/330 (29%)
C2H2 Zn finger 221..241 CDD:275368 1/19 (5%)
C2H2 Zn finger 249..269 CDD:275368 8/29 (28%)
C2H2 Zn finger 277..297 CDD:275368 5/19 (26%)
C2H2 Zn finger 305..327 CDD:275368 7/21 (33%)
C2H2 Zn finger 338..359 CDD:275368 9/20 (45%)
C2H2 Zn finger 367..384 CDD:275368 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 451..471 CDD:275368 9/19 (47%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
C2H2 Zn finger 508..528 CDD:275368 9/19 (47%)
C2H2 Zn finger 537..557 CDD:275368 8/19 (42%)
C2H2 Zn finger 565..582 CDD:275368 4/16 (25%)
ZNF468XP_016882932.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.