DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and ZNF26

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_016875409.1 Gene:ZNF26 / 7574 HGNCID:13053 Length:575 Species:Homo sapiens


Alignment Length:459 Identity:125/459 - (27%)
Similarity:203/459 - (44%) Gaps:83/459 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 EEQQQQYDEEVEEPITDESAPPQLTISYACKFCLRPQENYQLQQLLLEHINAS--HDP--EQPYN 220
            ||..|...:|:|          .:..||||.              :|..:|.|  ||.  ::.||
Human   131 EEWYQNNQDELE----------SIERSYACS--------------VLGRLNLSKTHDSSRQRLYN 171

  Fly   221 CPECEARFQDAASRTV------------------HLKSSHVEKQHACGVCGKKYGDRHNLRHHVE 267
            ..........|.||:.                  |.::..:||...|..|||.:..:..|..|:.
Human   172 TRGKSLTQNSAPSRSYLRKNPDKFHGYEEPYFLKHQRAHSIEKNCVCSECGKAFRCKSQLIVHLR 236

  Fly   268 KYHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTSS 332
            .:..|..:||:.||:.|..:.:||.|.:.|..::.:.|  |.||::|..:..|:.|:..|:|   
Human   237 IHTGERPYECSKCERAFSAKSNLNAHQRVHTGEKPYSC--SECEKVFSFRSQLIVHQEIHTG--- 296

  Fly   333 RKSEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIER 397
            .|...|..|||.:.....|..| .|.|.|.|||:|:.|.:.|:..:...:     |:...|.::.
Human   297 GKPYGCSECGKAYSWKSQLLLH-QRSHTGVKPYECSECGKAFSLKSPFVV-----HQRTHTGVKP 355

  Fly   398 SECMLCRQPFSSEPDLIHHMSAEHLQRPGAPIIANNKRVLQQKRERQYSGLFQCGSCSQRFNMKS 462
            .:|..|.:.|.|:..|:.|:.....::|                       :||..|.:.||||:
Human   356 HKCSECGKAFRSKSYLLVHIRMHTGEKP-----------------------YQCSDCGKAFNMKT 397

  Fly   463 ALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQHRLS 527
            .|..|..||: .:.|:.|..|.|.|.|.:.:..|::.|..|||..|..|||||:.|..|..||.:
Human   398 QLIVHQGVHT-GNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRT 461

  Fly   528 HEVLEKNFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDLCQERFVTHIKLKTHMQKAHAASQPH 592
            | ..|:.::|::|.||:..:..|.:|||||:.:..|:|:.|::.:.....|:.| ||.|:..:|.
Human   462 H-TGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIH-QKTHSGEKPF 524

  Fly   593 SADQ 596
            ...:
Human   525 KCSE 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 85/331 (26%)
C2H2 Zn finger 221..241 CDD:275368 4/37 (11%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
C2H2 Zn finger 305..327 CDD:275368 7/21 (33%)
C2H2 Zn finger 338..359 CDD:275368 7/20 (35%)
C2H2 Zn finger 367..384 CDD:275368 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 451..471 CDD:275368 8/19 (42%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
C2H2 Zn finger 508..528 CDD:275368 10/19 (53%)
C2H2 Zn finger 537..557 CDD:275368 8/19 (42%)
C2H2 Zn finger 565..582 CDD:275368 3/16 (19%)
ZNF26XP_016875409.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.