DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and ZNF8

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_066575.2 Gene:ZNF8 / 7554 HGNCID:13154 Length:575 Species:Homo sapiens


Alignment Length:439 Identity:106/439 - (24%)
Similarity:171/439 - (38%) Gaps:74/439 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 CQEAQLKLSHIYDKIDASSLEDDEIGQEDLEPAEEHQETETTKPTTTVSAETQPNNTASDPIEIF 144
            ||...|.|.      :.::|:..|.|.::....::..:|...:....:|:...|           
Human   143 CQSQSLALK------EQNNLKQLEFGLKEAPVQDQGYKTLRLRENCVLSSSPNP----------- 190

  Fly   145 VDAVDIDEAEEEEEEEEQQQQYDEEVEEPITDESAPPQLTISYACKFCLRPQENYQL-----QQL 204
                     ..|....|....||.::.:...:.|...|.|.|..    .:|.||...     |.:
Human   191 ---------FPEISRGEYLYTYDSQITDSEHNSSLVSQQTGSPG----KQPGENSDCHRDSSQAI 242

  Fly   205 LLEHINASHDPEQPYNCPECEARFQDAASRTVHLKSSHVEKQHACGVCGKKYGDRHNLRHHVEKY 269
            .:..:..|...::||.|.:|...|...|..|||.:....|:.:.|..|||.:....:|..|...:
Human   243 PITELTKSQVQDKPYKCTDCGKSFNHNAHLTVHKRIHTGERPYMCKECGKAFSQNSSLVQHERIH 307

  Fly   270 HSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTSSRK 334
            ..:..::||.|.|.|.....|..|.:.|..::.::|:  .|.|.|.....|..|:.||:|   .|
Human   308 TGDKPYKCAECGKSFCHSTHLTVHRRIHTGEKPYECQ--DCGRAFNQNSSLGRHKRTHTG---EK 367

  Fly   335 SEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERSE 399
            ...|..|||:|.....|..|: |.|..|:||:|.:|.:.|            ||..:|...:|..
Human   368 PYTCSVCGKSFSRTTCLFLHL-RTHTEERPYECNHCGKGF------------RHSSSLAQHQRKH 419

  Fly   400 C----MLCRQP--FSSEPDLIHHMSAEHLQRPGA-PIIANNKRVLQQKRERQYSGLFQCGSCSQR 457
            .    ..|||.  |...|.|..|...|.|   |. |.::.::|..:..|.      |:|..|.:.
Human   420 AGEKPFECRQRLIFEQTPALTKHEWTEAL---GCDPPLSQDERTHRSDRP------FKCNQCGKC 475

  Fly   458 FNMKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPN 506
            |...|.|.||...|:.:::||.   .|:|.:::.....|:..|  :.||
Human   476 FIQSSHLIRHQITHTREEQPHG---RSRRREQSSSRNSHLVQH--QHPN 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071 3/6 (50%)
COG5048 198..>508 CDD:227381 86/321 (27%)
C2H2 Zn finger 221..241 CDD:275368 7/19 (37%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
C2H2 Zn finger 305..327 CDD:275368 6/21 (29%)
C2H2 Zn finger 338..359 CDD:275368 8/20 (40%)
C2H2 Zn finger 367..384 CDD:275368 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 7/25 (28%)
C2H2 Zn finger 451..471 CDD:275368 7/19 (37%)
C2H2 Zn finger 480..500 CDD:275368 3/19 (16%)
C2H2 Zn finger 508..528 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..582 CDD:275368
ZNF8NP_066575.2 KRAB 25..85 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..130
COG5048 <167..404 CDD:227381 64/266 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..237 7/30 (23%)
C2H2 Zn finger 259..279 CDD:275368 7/19 (37%)
C2H2 Zn finger 287..307 CDD:275368 6/19 (32%)
C2H2 Zn finger 315..335 CDD:275368 7/19 (37%)
C2H2 Zn finger 343..363 CDD:275368 6/21 (29%)
C2H2 Zn finger 371..391 CDD:275368 8/20 (40%)
zf-C2H2 397..419 CDD:306579 8/33 (24%)
C2H2 Zn finger 399..419 CDD:275368 7/31 (23%)
zf-C2H2 467..489 CDD:306579 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..533 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.