DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and ZNF878

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_016882684.1 Gene:ZNF878 / 729747 HGNCID:37246 Length:567 Species:Homo sapiens


Alignment Length:553 Identity:149/553 - (26%)
Similarity:235/553 - (42%) Gaps:88/553 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NAFRLACQEAQLKLSHIYDKIDASSLEDDE----------IGQEDLEPAEEHQETE--TTKPTTT 126
            |.:|...||....|:.|..|.:...:||:.          ||:...|..|.||..|  |..|..|
Human    63 NLYREVMQETLRNLTSIGKKWNNQYIEDEHQNPRRNLRRLIGERLSESKESHQHGEVLTQVPDDT 127

  Fly   127 VSAETQPNNTASDPI--EIFVDAVDID---------------------EAEEEEEEEEQQQQYDE 168
            :..:|....:....:  ||.:....::                     |...|.:|..:..::..
Human   128 LKKKTPGVQSYESSVCGEIGIGLSSLNRHLRAFSYSSSLAIHGRTHTGEKPYECKECGKAFRFPS 192

  Fly   169 EV--EEPITDESAPPQLTISYACKFCLRPQENYQLQQLLLEHINASHDPEQPYNCPECEARFQDA 231
            .|  .|.|.....|      |.||.|   .:.:.....:..| ...|..::||.|.:|.......
Human   193 SVRRHERIHSAKKP------YECKQC---GKAFSFPSSVRRH-ERIHSAKKPYECKQCGKALSYL 247

  Fly   232 ASRTVHLKSSHVEKQHACGVCGKKYGDRHNLRHHVEKYHSETDFECALCEKRFYTRKSLNYHMKW 296
            .|...|::....|:.|.|.:|||.:....:|:.|.:.:..|..::|..|:|.|....|..||.:.
Human   248 VSFQTHMRMHTGERPHKCNICGKAFFSPSSLKRHEKSHTGEKRYKCKQCDKAFNCPSSFQYHERT 312

  Fly   297 HNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIYRQHGG 361
            |:.::.::|  :.|.:.|.|.::|..||..|:|   .|...|..|||.||...:.|:| .:.|.|
Human   313 HSGEKPYEC--TQCRKAFRSVKYLRVHERKHTG---EKPYECKLCGKGFISSTSFRYH-EKTHTG 371

  Fly   362 EKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERSECMLCRQPFSSEPDLIHHMSAEHLQRPG 426
            ||||:|..|.:.|:...:.|||  ||..   |..:..||..|.:.|:|.....:|          
Human   372 EKPYECKKCVKAFSFVKDLRIH--ERTH---TGEKPFECKQCGKTFTSSNSFHYH---------- 421

  Fly   427 APIIANNKRVLQQKRERQYSG--LFQCGSCSQRFNMKSALERHAAVHSEKDRPHACPHCSKRFKR 489
                           ||.::|  .::|..|.:.|...|.|::|...|: .::|:.|..|.|.|:.
Human   422 ---------------ERTHTGEKPYECKQCGKAFRSASVLQKHIRTHT-GEKPYGCKQCGKVFRV 470

  Fly   490 AQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQHRLSHEVLEKNFKCNVCGRAYLFEKSLRLHQ 554
            |..:|.|.:||..|||..|..|||||.....:..|:.:| ..||.:||..||:|::...|...|:
Human   471 ASQLKMHERTHTGEKPYECKQCGKAFISSNSIRYHKRTH-TGEKPYKCKQCGKAFISSNSFLYHE 534

  Fly   555 RTHTGKTYYKCDLCQERFVTHIKLKTHMQKAHA 587
            |.|||:..|:|..|.:.|.:...|:.|: :.||
Human   535 RIHTGEKPYECKQCGKAFRSASILQKHV-RTHA 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071 4/12 (33%)
COG5048 198..>508 CDD:227381 87/311 (28%)
C2H2 Zn finger 221..241 CDD:275368 4/19 (21%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
C2H2 Zn finger 305..327 CDD:275368 7/21 (33%)
C2H2 Zn finger 338..359 CDD:275368 8/20 (40%)
C2H2 Zn finger 367..384 CDD:275368 5/16 (31%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 7/19 (37%)
C2H2 Zn finger 508..528 CDD:275368 7/19 (37%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..582 CDD:275368 4/16 (25%)
ZNF878XP_016882684.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.