DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and Zfp426

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001073412.1 Gene:Zfp426 / 690895 RGDID:1590942 Length:553 Species:Rattus norvegicus


Alignment Length:399 Identity:113/399 - (28%)
Similarity:170/399 - (42%) Gaps:40/399 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 EQQQQYDEEVEEPITDESAPPQLTISYACKFCLRPQENYQLQQLLLEHINASHDPEQPYNCPECE 225
            |:..::::..|.......|..::.....|..|....:::..|..|..| ..:|..::.|...||.
  Rat   193 EKLSEFNQSEETGAIPGKAYQKMATQEKCFECSDCGKSFMNQSHLQTH-QRTHSGDKLYELNECG 256

  Fly   226 ARFQDAASR-TVHLKSSHVEKQHACGVCGKKYGDRHNLRHHVEKYHSETDFECALCEKRFYTRKS 289
            ..|.:  || .|.:::.:.:|.|.|..|||.|.....|..|:..:..|..:||..|.|.|....|
  Rat   257 RSFIN--SRLAVLIETLNAKKPHRCKECGKGYRYPAYLNIHMRTHTGEKPYECKECGKAFNYSNS 319

  Fly   290 LNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWH 354
            ...|.:.|..::.:.|..  |.:.|.....|..|..:|:|.   |...|..|||.|:....|..|
  Rat   320 FQIHGRTHTGEKPYVCNQ--CGKAFTQHSGLSIHVRSHNGD---KPYACKECGKAFLTSSRLIQH 379

  Fly   355 IYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERSECMLCRQPFSSEPDLIHHMSA 419
            | |.|.||||:.|..|.:.||..:....| |:.|.|..|.    ||.:|.:.|.....|.:||..
  Rat   380 I-RTHTGEKPFVCVKCGKAFAISSNLNGH-LKMHAEEKTC----ECKICGKAFGYLSCLNNHMRT 438

  Fly   420 EHLQRPGAPIIANNKRVLQQKRERQYSGLFQCGSCSQRFNMKSALERHAAVHSEKDRPHACPHCS 484
            .:.::.                       :.|..|.:.||..:.|:.|..:|: .::|:.|..|.
  Rat   439 HNAKKS-----------------------YTCKECGKAFNYSTHLKIHMRIHT-GEKPYECKQCG 479

  Fly   485 KRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQHRLSH-EVLEKNFKCNVCGRAYLFEK 548
            |.|..:...:.|.:||..|||..|..|||||........|.:|| ...||.:||..||:||...:
  Rat   480 KAFSHSTSFQIHERTHTGEKPYECKECGKAFICPSSFRIHEISHTHTEEKPYKCQQCGKAYSHPR 544

  Fly   549 SLRLHQRTH 557
            |||.|:|.|
  Rat   545 SLRRHERIH 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 85/310 (27%)
C2H2 Zn finger 221..241 CDD:275368 6/20 (30%)
C2H2 Zn finger 249..269 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 305..327 CDD:275368 5/21 (24%)
C2H2 Zn finger 338..359 CDD:275368 9/20 (45%)
C2H2 Zn finger 367..384 CDD:275368 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 5/19 (26%)
C2H2 Zn finger 508..528 CDD:275368 7/19 (37%)
C2H2 Zn finger 537..557 CDD:275368 10/19 (53%)
C2H2 Zn finger 565..582 CDD:275368
Zfp426NP_001073412.1 KRAB 40..97 CDD:214630
zf-C2H2 222..244 CDD:395048 4/22 (18%)
C2H2 Zn finger 224..244 CDD:275368 4/20 (20%)
C2H2 Zn finger 279..299 CDD:275368 7/19 (37%)
zf-H2C2_2 291..316 CDD:404364 8/24 (33%)
C2H2 Zn finger 307..327 CDD:275368 6/19 (32%)
COG5048 <331..483 CDD:227381 49/186 (26%)
C2H2 Zn finger 335..355 CDD:275368 5/21 (24%)
C2H2 Zn finger 363..383 CDD:275368 9/20 (45%)
C2H2 Zn finger 391..411 CDD:275368 6/20 (30%)
C2H2 Zn finger 419..439 CDD:275368 6/19 (32%)
C2H2 Zn finger 447..467 CDD:275368 6/19 (32%)
C2H2 Zn finger 475..495 CDD:275368 5/19 (26%)
zf-H2C2_2 487..512 CDD:404364 12/24 (50%)
C2H2 Zn finger 503..523 CDD:275368 7/19 (37%)
C2H2 Zn finger 533..553 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.