DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and ZNF701

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001166126.1 Gene:ZNF701 / 55762 HGNCID:25597 Length:531 Species:Homo sapiens


Alignment Length:387 Identity:109/387 - (28%)
Similarity:155/387 - (40%) Gaps:87/387 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 SHDPEQPYNCPE------CEARFQDAASRTVHLKSSHVEKQHACGVCGKKYGDRHN------LRH 264
            ||.||.....||      .|....||.|.:...:.|...|..    ...||  |:|      |..
Human   212 SHLPEVHIFHPEGKIGNQVEKAINDAFSVSASQRISCRPKTR----ISNKY--RNNFLQSSLLTQ 270

  Fly   265 HVEKYHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSG 329
            ..|.:..|..|:.....|.|.....|..|...|..|:|:||  ..|.:.|..:|:|.||.. |:|
Human   271 KREVHTREKSFQRNESGKAFNGSSLLKKHQIIHLGDKQYKC--DVCGKDFHQKRYLACHRC-HTG 332

  Fly   330 TSSRKSEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTA 394
            .:...   |..|||||.|...|..| ...|.|||||||..|.:|                     
Human   333 ENPYT---CNECGKTFSHNSALLVH-KAIHTGEKPYKCNECGKV--------------------- 372

  Fly   395 IERSECMLCRQPFSSEPDLIHHMSAEHLQRPGAPIIANNKRVLQQKRERQYSGLFQCGSCSQRFN 459
                        |:.:.:|..|......::|                       ::|..|.:.|:
Human   373 ------------FNQQSNLARHHRVHTGEKP-----------------------YKCEECDKVFS 402

  Fly   460 MKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQH 524
            .||.||||..:|: .::|:.|..|.|.|:|...:..|...|..|||..|:.|||.|.....|..|
Human   403 RKSHLERHRRIHT-GEKPYKCKVCDKAFRRDSHLAQHTVIHTGEKPYKCNECGKTFVQNSSLVMH 466

  Fly   525 RLSHEVLEKNFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDLCQERFVTHIKLKTHMQKAH 586
            ::.| ..||.:|||.||:.:..:.:|..|:|.|||:..|||:.|.:.|    ..|:::::.|
Human   467 KVIH-TGEKRYKCNECGKVFNHKSNLACHRRLHTGEKPYKCNECGKVF----NRKSNLERHH 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 81/307 (26%)
C2H2 Zn finger 221..241 CDD:275368 6/25 (24%)
C2H2 Zn finger 249..269 CDD:275368 6/25 (24%)
C2H2 Zn finger 277..297 CDD:275368 4/19 (21%)
C2H2 Zn finger 305..327 CDD:275368 7/21 (33%)
C2H2 Zn finger 338..359 CDD:275368 9/20 (45%)
C2H2 Zn finger 367..384 CDD:275368 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 3/19 (16%)
C2H2 Zn finger 451..471 CDD:275368 9/19 (47%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
C2H2 Zn finger 508..528 CDD:275368 7/19 (37%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..582 CDD:275368 4/16 (25%)
ZNF701NP_001166126.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
KRAB 74..>114 CDD:214630
KRAB 74..113 CDD:279668
C2H2 Zn finger 283..303 CDD:275368 4/19 (21%)
zf-H2C2_2 296..320 CDD:290200 9/25 (36%)
C2H2 Zn finger 311..330 CDD:275368 7/21 (33%)
C2H2 Zn finger 338..358 CDD:275368 9/20 (45%)
zf-H2C2_2 350..375 CDD:290200 13/58 (22%)
C2H2 Zn finger 366..386 CDD:275368 6/52 (12%)
zf-H2C2_2 378..403 CDD:290200 6/47 (13%)
COG5048 <390..527 CDD:227381 50/163 (31%)
C2H2 Zn finger 394..414 CDD:275368 9/19 (47%)
zf-H2C2_2 406..431 CDD:290200 10/25 (40%)
C2H2 Zn finger 422..442 CDD:275368 6/19 (32%)
zf-H2C2_2 434..459 CDD:290200 10/24 (42%)
C2H2 Zn finger 450..470 CDD:275368 7/19 (37%)
zf-H2C2_2 462..487 CDD:290200 10/25 (40%)
C2H2 Zn finger 478..498 CDD:275368 7/19 (37%)
zf-H2C2_2 490..515 CDD:290200 11/28 (39%)
C2H2 Zn finger 506..526 CDD:275368 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.