DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8301 and AgaP_AGAP011411

DIOPT Version :9

Sequence 1:	NP_649915.1	Gene:	CG8301 / 41160	FlyBaseID:	FBgn0037717	Length:	607	Species:	Drosophila melanogaster
Sequence 2:	XP_317900.3	Gene:	AgaP_AGAP011411 / 4577542	VectorBaseID:	AGAP011411	Length:	197	Species:	Anopheles gambiae

Alignment Length:	144	Identity:	29/144 - (20%)
Similarity:	55/144 - (38%)	Gaps:	46/144 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly    50 LKISPNDGLPQKICSDC---------FTKFCSIN--AFRLACQEAQLKLSHIYDKIDASSLEDD- 102
            :::...:.:|..:|.:|         |...|..|  .||....:..:..|:..|:.:|.|.:.|
Mosquito    44 IELETAETVPYVVCGNCKDILNQSVQFRNICVSNDVLFRELFSQCTIPSSNSNDETEARSKQKDT 108

  Fly   103 ---EIGQEDLEPAEEHQETETTKPTTTVSAETQPNNTASDPIEIFVDAVDIDEAEEEEEEEEQQQ 164
               ||....|:.|.:.:                 |..:.|..|:|::           :.|.::.
Mosquito   109 GLIEIEIMYLKEASKER-----------------NGLSQDLTEVFLN-----------DSEGRED 145

  Fly   165 QYDEEVEEPITDES 178
            |:||.|   |:||:
Mosquito   146 QFDEAV---ISDEA 156

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8301	NP_649915.1	zf-AD	3..87	CDD:285071	8/47 (17%)
		COG5048	198..>508	CDD:227381
		C2H2 Zn finger	221..241	CDD:275368
		C2H2 Zn finger	249..269	CDD:275368
		C2H2 Zn finger	277..297	CDD:275368
		C2H2 Zn finger	305..327	CDD:275368
		C2H2 Zn finger	338..359	CDD:275368
		C2H2 Zn finger	367..384	CDD:275368
		C2H2 Zn finger	400..420	CDD:275368
		C2H2 Zn finger	451..471	CDD:275368
		C2H2 Zn finger	480..500	CDD:275368
		C2H2 Zn finger	508..528	CDD:275368
		C2H2 Zn finger	537..557	CDD:275368
		C2H2 Zn finger	565..582	CDD:275368
AgaP_AGAP011411	XP_317900.3	zf-AD	10..84	CDD:285071	8/39 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000098
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000