DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and CG4360

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_650879.1 Gene:CG4360 / 42413 FlyBaseID:FBgn0038787 Length:556 Species:Drosophila melanogaster


Alignment Length:450 Identity:101/450 - (22%)
Similarity:155/450 - (34%) Gaps:108/450 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 QLQQLLLEHINASHDPEQPYNCPECEARFQDAASRTVHLKSSHVEKQHACGVCGKKYGDRHNLRH 264
            ::|.::.|......||.:...|..|:.:|:...:...|:|....|:.:.|..|.|.:.....|.:
  Fly   123 EVQSVISEEEVVVDDPRKKKQCHVCKNKFRQLTTLRNHMKIHTDERPYKCKHCDKAFRQISTLTN 187

  Fly   265 HVEKYHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQF---------------KCRHSGCERLF 314
            ||:.:..|..|.|.:|.|.|..:.:|..|:|.|......               |.|.|...:.:
  Fly   188 HVKIHTGEKPFTCNICAKDFRQQSTLINHIKTHKAAESSTPTSLLNYQPQTGSGKHRKSQMHQAY 252

  Fly   315 ISQRH--LMCHEATHSGTSSR-------KSEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANC 370
             .|:|  :...:..:||:.|.       |...|..|.:.|..|.||..| .|.|...|||||..|
  Fly   253 -QQQHQRVQISKTLYSGSYSSPAAEELVKPFQCSVCKRRFPQLSTLHNH-ERTHIDPKPYKCETC 315

  Fly   371 TEVFASYAEKRIHMLERHRENLTAIERSECMLCRQPFSSEPDLIHHMSAE-HLQRPG-------- 426
            .:.|:..|     .|..|::..|..:...|..|...|..:..|.:|:... |...||        
  Fly   316 DKSFSQLA-----TLANHKKIHTGDKPYTCSYCHMQFRQQSTLTNHLKTHTHQIAPGGVGGAGGG 375

  Fly   427 -------------APIIANNKRVLQQKRERQYSGLFQCGSCSQRFNMKSALERHAAVH------- 471
                         ||:....:::.        |||..........|: ..|:.|..:|       
  Fly   376 GGAVTATVDHSMPAPLAPGTQQLT--------SGLLPNNLHGSTANI-IQLDHHPLLHFLDGSTT 431

  Fly   472 --------------------------------------SEKDRPHACPHCSKRFKRAQDMKWHIK 498
                                                  ...|||..|..|.:.|.:...:..|||
  Fly   432 VSSVVATAAANTKVEHFQAGGSPSGRMTVVGTINMLKGDNPDRPFGCSVCQRFFSQQSTLVNHIK 496

  Fly   499 THEKEKPNVCDVCGKAFALKYVLTQHRLSHEVLEKNFKCNVCGRAYLFEKSLRLHQRTHT 558
            ||..|||..|.:|...|.....|..|...| ..||.:.|:.|.:.:..:.:|:.|.|.||
  Fly   497 THTGEKPYKCKICEVNFRQVATLNNHMKIH-TGEKPYNCSFCPKQFRQKSTLQNHLRVHT 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 86/398 (22%)
C2H2 Zn finger 221..241 CDD:275368 5/19 (26%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
C2H2 Zn finger 305..327 CDD:275368 4/23 (17%)
C2H2 Zn finger 338..359 CDD:275368 8/20 (40%)
C2H2 Zn finger 367..384 CDD:275368 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 451..471 CDD:275368 3/19 (16%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
C2H2 Zn finger 508..528 CDD:275368 5/19 (26%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 565..582 CDD:275368
CG4360NP_650879.1 C2H2 Zn finger 144..164 CDD:275368 5/19 (26%)
zf-H2C2_2 157..181 CDD:290200 6/23 (26%)
C2H2 Zn finger 172..192 CDD:275368 6/19 (32%)
zf-H2C2_2 185..209 CDD:290200 9/23 (39%)
C2H2 Zn finger 200..220 CDD:275368 7/19 (37%)
C2H2 Zn finger 284..304 CDD:275368 8/20 (40%)
zf-C2H2_8 287..363 CDD:292531 24/81 (30%)
C2H2 Zn finger 312..332 CDD:275368 6/24 (25%)
C2H2 Zn finger 340..360 CDD:275368 5/19 (26%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
zf-H2C2_2 491..515 CDD:290200 11/23 (48%)
C2H2 Zn finger 506..526 CDD:275368 5/19 (26%)
zf-H2C2_2 519..543 CDD:290200 7/24 (29%)
C2H2 Zn finger 534..554 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.