DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and CG6654

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:711 Identity:167/711 - (23%)
Similarity:244/711 - (34%) Gaps:234/711 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CRTCAISM--FVCDFENGSNNSHFLDLHHPNCWPSEMAQIRLQFANWNLKISP--NDGLPQKICS 64
            |.||..|.  .:..::.||.          :|    :|.:..:|.    |..|  ||.||:|:|.
  Fly     7 CLTCLSSTGPLLSIYDGGSG----------SC----LADMIREFT----KTKPRRNDNLPEKVCL 53

  Fly    65 DCFTKFCSINAFRLACQEAQLKLSHIY---------DKIDAS----------------------S 98
            .|.::..:...|::.|:.:...|..:.         .|:..|                      |
  Fly    54 SCLSEISNCYTFKIKCENSSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWEPDRCTAS 118

  Fly    99 LEDDEIGQEDLEPAEEHQETETTKPTTTVSAETQPNNTASD------PIE--------------- 142
            ::.|.:...|.|     |.|...|.|.:|..:.:......|      |:|               
  Fly   119 VQTDAVTTTDAE-----QNTSLIKSTISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGNLKD 178

  Fly   143 ----IFVDAVDIDEAEEEEEEEEQQ-------QQYDEEVEEPITDESAPPQLTISYACKFCLRPQ 196
                :|.....|.|.::.|.|::.:       :..|.|.|  |...:||...|...|.|      
  Fly   179 EKEVVFTQTNVIYEGDDHELEQQIRECNLAIFEGVDNEAE--IITVTAPQVTTRKSAAK------ 235

  Fly   197 ENYQLQQLLLEHINASHDPEQPYNCPECEAR------FQDAASRTVHLKS-----------SHVE 244
                   ||.:..|..|  :.|....| |||      ...:|.||...:.           |..|
  Fly   236 -------LLTQQENDKH--QTPVGSKE-EARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAE 290

  Fly   245 ---KQHACGVCGKKYGDRHNLRHHVE-----------KYHSETDFECALCEKRFYTRKSLNYHMK 295
               |||..|...|....|....:...           |||      |..|...|...|||..|.:
  Fly   291 PSPKQHRLGTQRKLSAPRAGTVNGPSTTSGAATTPELKYH------CDRCNAGFAVEKSLMIHRR 349

  Fly   296 WHN-PDRQFKCRHSGCERLFISQRHLMCHEATHSG-----------TSSRKSEH----------- 337
            ... .:|.:||..  ||::|:|..||..|:|:|..           :....|:|           
  Fly   350 QKGCINRNYKCNE--CEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEALSKHMVQGHKRNLRN 412

  Fly   338 -CGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERSECM 401
             |..|.|.|..|.|||.|: |.|.||||:.|..|.:.|...|..|.|.| ||.|.    :..:|.
  Fly   413 QCNICQKVFTMLSTLRDHM-RIHTGEKPFVCNICGKSFTQNANLRQHKL-RHSET----KSFKCE 471

  Fly   402 LCRQPFSSEPDLIHHMSAEHLQRPGAPIIANNKRVLQQKRERQYSGLFQCGSCSQRFNMKSALER 466
            ||...|.::.:|..|.......:|                       |:|..|..||....:|.:
  Fly   472 LCPHSFVTKAELTSHARTHTGDKP-----------------------FECEVCLARFTTSCSLAK 513

  Fly   467 HAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQHRLSHEVL 531
            |...|: .:||:||..|..||.....:|.|.:||..|:|.||..|.|.|      ||        
  Fly   514 HKRKHT-GERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTF------TQ-------- 563

  Fly   532 EKNFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDLCQERFVTHIKLKTHMQKAHAASQPH 592
                           ....::|||||.|:..|.|.:|.|.|.:..::::|:    |..:.|
  Fly   564 ---------------RGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHL----AGHEQH 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071 20/86 (23%)
COG5048 198..>508 CDD:227381 97/364 (27%)
C2H2 Zn finger 221..241 CDD:275368 7/36 (19%)
C2H2 Zn finger 249..269 CDD:275368 3/30 (10%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
C2H2 Zn finger 305..327 CDD:275368 9/21 (43%)
C2H2 Zn finger 338..359 CDD:275368 10/20 (50%)
C2H2 Zn finger 367..384 CDD:275368 5/16 (31%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
C2H2 Zn finger 508..528 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 3/19 (16%)
C2H2 Zn finger 565..582 CDD:275368 4/16 (25%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 21/89 (24%)
C2H2 Zn finger 331..354 CDD:275368 7/22 (32%)
COG5048 <357..570 CDD:227381 73/273 (27%)
C2H2 Zn finger 360..380 CDD:275368 9/21 (43%)
C2H2 Zn finger 385..406 CDD:275370 2/20 (10%)
C2H2 Zn finger 414..434 CDD:275368 10/20 (50%)
zf-H2C2_2 427..451 CDD:290200 12/24 (50%)
C2H2 Zn finger 442..490 CDD:275368 16/52 (31%)
C2H2 Zn finger 470..487 CDD:275368 5/16 (31%)
zf-H2C2_2 482..507 CDD:290200 8/47 (17%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 510..534 CDD:290200 9/24 (38%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 539..563 CDD:290200 11/29 (38%)
C2H2 Zn finger 554..574 CDD:275368 9/48 (19%)
C2H2 Zn finger 582..602 CDD:275368 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2264
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.