DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and CG14710

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:469 Identity:107/469 - (22%)
Similarity:182/469 - (38%) Gaps:123/469 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CRTCAISMFVCDFENGSNNSHFLDLHHPNCWPSEMAQIRLQFANWNLKISPNDGLPQKICSDCFT 68
            ||.|     :.|||.......|.|...     |::.: :|:.. ..:::..:..||:|.|:.|  
  Fly    10 CRIC-----LGDFEESQMICLFGDKGE-----SDLRK-KLELC-CRIRVRQSPQLPEKACNSC-- 60

  Fly    69 KFCSINA----FRLACQEAQL--------------------KLSHIYD----KIDASSLEDDEIG 105
              |....    ||..|..:|:                    .:.::|:    |:...:.|.:|| 
  Fly    61 --CEFVQMWFNFRQMCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEI- 122

  Fly   106 QEDLEPAEEHQETETTKP--------TTTVSAETQPNNTASDPIEIFVDAVD--IDEAEEEEEEE 160
             ..:|..:|.||.::.:.        ..::..:.:||  ...|.:|.:..:|  :|:.:.||..:
  Fly   123 -TAIEEGDEQQEDQSQEVLDFNGFIINESIEEDEEPN--TESPEQILISHMDSYVDDQQMEELID 184

  Fly   161 EQQQQYDE--------EVE---EPITDESAPPQLTISYACKFCLRPQENYQLQQLLLEHINASHD 214
            ::.:..:|        |||   |.:...|||             .|..::::.:         ..
  Fly   185 DKGELVEELSNANTFYEVEYGDEELLMSSAP-------------SPHPSFKMDK---------QK 227

  Fly   215 PEQPYNCPECEARFQ----DAASRTVHLKSSHVEKQHACGVCG-----KKYGDRHNLRHHVEKYH 270
            |.:|.. |:.|.:|:    :|..|....|....|| ..|.:||     |.....|.:.|...|.|
  Fly   228 PGRPRK-PDAELKFKRKDINAKERGNQPKCKEEEK-FMCILCGNVFYKKSVFTAHMMTHSEYKPH 290

  Fly   271 SETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTSSRKS 335
                 :|.:|.|.|.....|..|::.|..||.:||.:  |:|.|..:...:.||..|:.|   :.
  Fly   291 -----QCEICNKSFRQMGELRAHIRRHTGDRPYKCMY--CDRHFYDRSERVRHERVHTNT---RP 345

  Fly   336 EHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERSEC 400
            ..|..|||||.|...|:.||. .|..:|.|.|..|.:.|.     .:|.|:.|.:.||...:.| 
  Fly   346 YACQECGKTFTHTAILKNHIL-SHSAQKNYNCGICCKSFT-----LLHQLKAHLQTLTHRNKME- 403

  Fly   401 MLCRQPFSSEPDLI 414
                |...|.|:::
  Fly   404 ----QTIPSSPEML 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071 20/106 (19%)
COG5048 198..>508 CDD:227381 61/226 (27%)
C2H2 Zn finger 221..241 CDD:275368 6/23 (26%)
C2H2 Zn finger 249..269 CDD:275368 6/24 (25%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 305..327 CDD:275368 6/21 (29%)
C2H2 Zn finger 338..359 CDD:275368 10/20 (50%)
C2H2 Zn finger 367..384 CDD:275368 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 3/15 (20%)
C2H2 Zn finger 451..471 CDD:275368
C2H2 Zn finger 480..500 CDD:275368
C2H2 Zn finger 508..528 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..582 CDD:275368
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 20/88 (23%)
COG5048 <261..395 CDD:227381 46/150 (31%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-C2H2 290..312 CDD:278523 7/26 (27%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
zf-H2C2_2 304..327 CDD:290200 9/24 (38%)
C2H2 Zn finger 320..340 CDD:275368 6/21 (29%)
zf-H2C2_2 335..357 CDD:290200 10/24 (42%)
C2H2 Zn finger 348..368 CDD:275368 10/20 (50%)
C2H2 Zn finger 376..395 CDD:275368 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.