DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and CG10494

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_726079.1 Gene:CG10494 / 37453 FlyBaseID:FBgn0034634 Length:523 Species:Drosophila melanogaster


Alignment Length:338 Identity:68/338 - (20%)
Similarity:111/338 - (32%) Gaps:93/338 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 HLM-CHEATH--SGTSSRKSEHCGFCG---KTF---IHLKTLRWHIYRQHGGEKPYKCA------ 368
            ||| ...|:|  |..||.|:..|.:..   :||   ||...|:..:.|.....|.::..      
  Fly    23 HLMNLGNASHSVSENSSGKASRCKWTSAKVETFLEIIHQLKLQAALRRPRSNAKVFRMVSREMAR 87

  Fly   369 -NCTEVFASYAEKRIHMLERHRENLTAIERSECMLCRQPFSSEPDLIHHMSAEHLQRPGAPIIAN 432
             ||.: ...:...:.|.:.|             ...|.....||  ..|..|.|....|..:...
  Fly    88 RNCPK-SPKHLRVKFHQMRR-------------QYARARNGGEP--FEHFEAVHELMQGEDVSDL 136

  Fly   433 NKRVLQQKRERQYSGLFQCGSCSQRFNMKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHI 497
            ::..|:...:.:        :...:..|.|..|...|:.:.....:....|          ||  
  Fly   137 DEEALESDSDME--------ADEDQSGMISETEGDDALDASGSSVNIVARC----------KW-- 181

  Fly   498 KTHEKEKPNVCDVCGKAFALKYVLTQHR-------LSHEVLEKNFKCNVCGRAYL---FEKSLRL 552
              .|.|...:.|:. ....|:..|.|.|       ||.|:.::|  |:. |...|   |::..||
  Fly   182 --AEGEVDLLLDLI-HTLGLRAALLQKRNAKVFKLLSKEMAKRN--CHK-GAEKLRIKFQQLRRL 240

  Fly   553 HQRTH--TGKTY-------YKCDLCQERFVTHIKLKTHMQKAH------------AASQPHSA-- 594
            :.:..  ||||:       ...|..:|......:.:.|:..|.            .|||...|  
  Fly   241 YNKVKNGTGKTFEHFEAMRLVLDPTEEEAAADAEAEAHLSSASDSDFNDSDEEEGDASQRSGAHF 305

  Fly   595 --DQPLDDLINIV 605
              |:.:|..:.|:
  Fly   306 WTDEEVDSFLLII 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 38/204 (19%)
C2H2 Zn finger 221..241 CDD:275368
C2H2 Zn finger 249..269 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 305..327 CDD:275368 4/8 (50%)
C2H2 Zn finger 338..359 CDD:275368 7/26 (27%)
C2H2 Zn finger 367..384 CDD:275368 2/23 (9%)
C2H2 Zn finger 400..420 CDD:275368 4/19 (21%)
C2H2 Zn finger 451..471 CDD:275368 4/19 (21%)
C2H2 Zn finger 480..500 CDD:275368 3/19 (16%)
C2H2 Zn finger 508..528 CDD:275368 6/26 (23%)
C2H2 Zn finger 537..557 CDD:275368 6/22 (27%)
C2H2 Zn finger 565..582 CDD:275368 2/16 (13%)
CG10494NP_726079.1 Myb_DNA-bind_4 44..123 CDD:290549 16/94 (17%)
Myb_DNA-bind_4 178..257 CDD:290549 24/96 (25%)
Myb_DNA-bind_4 303..391 CDD:290549 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.