DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and CG12744

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_610530.1 Gene:CG12744 / 36024 FlyBaseID:FBgn0033459 Length:160 Species:Drosophila melanogaster


Alignment Length:96 Identity:24/96 - (25%)
Similarity:44/96 - (45%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 ACPHCSKRFKRAQDMKWHIKTHEKEKPN---VCDVCGKAFALKYVLTQH-RLSHEV----LEKNF 535
            :|..|.:.|...:.:..|:.||..:..:   .||:||:.......|.|| :..||.    .|.:|
  Fly    11 SCLLCEQTFDATEKLDEHLPTHFPQPVSTGQTCDICGRTMRSSLELHQHYKRYHEAHVPNTEGHF 75

  Fly   536 KCNVCGRAYLFEKSLRLHQRTHTGKTYYKCD 566
            :|.:|.:.:|.:..|::|.:.......|:.|
  Fly    76 QCQLCDKVFLLQDHLKVHVKIEHATDGYQPD 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 6/31 (19%)
C2H2 Zn finger 221..241 CDD:275368
C2H2 Zn finger 249..269 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 305..327 CDD:275368
C2H2 Zn finger 338..359 CDD:275368
C2H2 Zn finger 367..384 CDD:275368
C2H2 Zn finger 400..420 CDD:275368
C2H2 Zn finger 451..471 CDD:275368
C2H2 Zn finger 480..500 CDD:275368 4/19 (21%)
C2H2 Zn finger 508..528 CDD:275368 7/20 (35%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 565..582 CDD:275368 1/2 (50%)
CG12744NP_610530.1 C2H2 Zn finger 12..32 CDD:275368 4/19 (21%)
C2H2 Zn finger 43..64 CDD:275368 7/20 (35%)
C2H2 Zn finger 77..96 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000098
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.