DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8301 and CG12744

DIOPT Version :9

Sequence 1:	NP_649915.1	Gene:	CG8301 / 41160	FlyBaseID:	FBgn0037717	Length:	607	Species:	Drosophila melanogaster
Sequence 2:	NP_610530.1	Gene:	CG12744 / 36024	FlyBaseID:	FBgn0033459	Length:	160	Species:	Drosophila melanogaster

Alignment Length:	96	Identity:	24/96 - (25%)
Similarity:	44/96 - (45%)	Gaps:	8/96 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   479 ACPHCSKRFKRAQDMKWHIKTHEKEKPN---VCDVCGKAFALKYVLTQH-RLSHEV----LEKNF 535
            :|..|.:.|...:.:..|:.||..:..:   .||:||:.......|.|| :..||.    .|.:|
  Fly    11 SCLLCEQTFDATEKLDEHLPTHFPQPVSTGQTCDICGRTMRSSLELHQHYKRYHEAHVPNTEGHF 75

  Fly   536 KCNVCGRAYLFEKSLRLHQRTHTGKTYYKCD 566
            :|.:|.:.:|.:..|::|.:.......|:.|
  Fly    76 QCQLCDKVFLLQDHLKVHVKIEHATDGYQPD 106

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8301	NP_649915.1	zf-AD	3..87	CDD:285071
		COG5048	198..>508	CDD:227381	6/31 (19%)
		C2H2 Zn finger	221..241	CDD:275368
		C2H2 Zn finger	249..269	CDD:275368
		C2H2 Zn finger	277..297	CDD:275368
		C2H2 Zn finger	305..327	CDD:275368
		C2H2 Zn finger	338..359	CDD:275368
		C2H2 Zn finger	367..384	CDD:275368
		C2H2 Zn finger	400..420	CDD:275368
		C2H2 Zn finger	451..471	CDD:275368
		C2H2 Zn finger	480..500	CDD:275368	4/19 (21%)
		C2H2 Zn finger	508..528	CDD:275368	7/20 (35%)
		C2H2 Zn finger	537..557	CDD:275368	5/19 (26%)
		C2H2 Zn finger	565..582	CDD:275368	1/2 (50%)
CG12744	NP_610530.1	C2H2 Zn finger	12..32	CDD:275368	4/19 (21%)
		C2H2 Zn finger	43..64	CDD:275368	7/20 (35%)
		C2H2 Zn finger	77..96	CDD:275368	5/18 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000098
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.000