DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and Lime

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_610529.1 Gene:Lime / 36023 FlyBaseID:FBgn0033458 Length:487 Species:Drosophila melanogaster


Alignment Length:409 Identity:72/409 - (17%)
Similarity:141/409 - (34%) Gaps:100/409 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 IDASSLEDDEIGQEDL-EPAEEHQETETTK---------PTTTVSAETQPNNTASDPI--EIFVD 146
            :||.|..|.||.:.:| .....|::||..:         |:...|....|.:....|:  ||...
  Fly     1 MDAESDSDVEIIETELMNHHHHHRQTEPKRHPAKMYPQIPSAIPSPPFSPTDPTDMPLVKEILAR 65

  Fly   147 AVDIDEAE----------------EEEEEEEQQQQYDEEV----EEPITDESAPPQLT--ISYAC 189
            :..|:..|                :.|..:|...|:..|:    .....:::.||.:|  :....
  Fly    66 SEHINVPEGTVLCVPCYLCKQPFNDIESFKEHLTQHAAEINAWNNTRAQEQTPPPTITPFVQSMN 130

  Fly   190 KFCLRPQENYQLQQL----LLEHINASHDPEQPYNCP----------ECEARFQDAA--SRTVHL 238
            |..:.|.:.:....:    :..|.||.:.....:.||          |.|..||..|  ...:.:
  Fly   131 KPFVHPTDQHLFHSIDHGDMDHHHNAHYRNRMEFGCPPPMDFYSPPLEPEIPFQMPAVHQHPIQI 195

  Fly   239 KSSHVEKQHACGVCGKKY-GDR--------------------HNLRHHV-EKYHSETDFECALCE 281
            ...::..||.......:: |.|                    |.:...: ...|:..:.:.....
  Fly   196 PPMYMTAQHTAYEPPVQFLGHRPLELRQKLPMSPQSPLEPSGHPMASAIPSNQHTSLEMQNLCVP 260

  Fly   282 KRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTS---SRKSEHCGFCGK 343
            :...||......::...|..|...:.:|..:   |:..::......:..|   ::....|.:|||
  Fly   261 EGILTRVEEPPVLENPRPQAQDPIQDAGAGK---SRSAVLIEPKPPNAKSLAFNQGQFECNWCGK 322

  Fly   344 TFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERSECMLCRQPFS 408
            .....::|::|....||.:                |..::.||:   |||  ::.:|:.|::.:.
  Fly   323 RLSSRQSLKYHESHFHGNK----------------ELAVNRLEK---NLT--KQHKCLTCKKRYK 366

  Fly   409 SEPDLIHHMSAEH-LQRPG 426
            ....|:.||..:| :..||
  Fly   367 RRTFLLMHMKVKHGIAFPG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 45/271 (17%)
C2H2 Zn finger 221..241 CDD:275368 7/31 (23%)
C2H2 Zn finger 249..269 CDD:275368 3/41 (7%)
C2H2 Zn finger 277..297 CDD:275368 2/19 (11%)
C2H2 Zn finger 305..327 CDD:275368 2/21 (10%)
C2H2 Zn finger 338..359 CDD:275368 6/20 (30%)
C2H2 Zn finger 367..384 CDD:275368 1/16 (6%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 451..471 CDD:275368
C2H2 Zn finger 480..500 CDD:275368
C2H2 Zn finger 508..528 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..582 CDD:275368
LimeNP_610529.1 C2H2 Zn finger 317..336 CDD:275368 6/18 (33%)
C2H2 Zn finger 358..377 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000098
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.