DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and CG30431

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:428 Identity:104/428 - (24%)
Similarity:173/428 - (40%) Gaps:67/428 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CRTCAISMFVCDFENGSNNSHFLDLHHPNCWPSEMAQIRLQFANWNLKISPNDGLPQKICSDCFT 68
            ||.|.:..              ..|:|.....|....:.|:.....|::...|.|...||..|..
  Fly    12 CRCCLLEQ--------------PPLYHSLYDASSQLAVELKALAPALRLEHGDNLTDVICDLCLR 62

  Fly    69 KFCSINAFRLACQEAQ--LKLSHIYDKI-----DASSLED------DEIGQEDLEPAEEHQETET 120
            :......|:..|:.::  |::.|.:.|.     ||.:|:|      .|:|  .|| .......:.
  Fly    63 RLHDARDFQRRCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLEREVG--SLE-GPMSVPLQA 124

  Fly   121 TKPTTTV----------SAETQPNNTASDPI----EIFVDAVDIDEAEEEEEEEE----QQQQYD 167
            :||...|          |.:.|.::.:...|    |..||:..::....:.|..|    :.....
  Fly   125 SKPVAHVAPLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPTPP 189

  Fly   168 EEVEEPITDESAPPQLTISYACKFCLRPQENYQLQQLLLEHINASHDPEQPYNCPECEARFQDAA 232
            |..|||..|.:..|::..:...:..::|:|.        :...|.| |...:.|||||.:|....
  Fly   190 ESSEEPAPDAAEKPKMRRARPRQDNVKPKER--------KASGAVH-PRSLHPCPECEKKFTRNF 245

  Fly   233 SRTVHLKSSH--VEKQHACGVCGKKYGDRHNLRHHVEKYHS-ETDFECALCEKRFYTRKSLNYHM 294
            ...:|:.:.|  .|.::.|..|.|.:..||:||:||:..|| |..|.|..|::||..|..|..|:
  Fly   246 QLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHL 310

  Fly   295 KWHNPD---RQFKCRHSGCERLFISQRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIY 356
            :.|..:   |.|:|:.  |.:.:.::..|..|..:|:....|..: |..|.|.|.....|..|:.
  Fly   311 RTHTGEAKPRIFECQR--CSKSWPTKSDLRTHMRSHNPNMERPFK-CDRCSKAFFTRGHLNSHLL 372

  Fly   357 RQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTA 394
             .|.||||:.|..|.:.:.|......||:..|.:.:.|
  Fly   373 -VHTGEKPFACEYCDKCYQSVGNLNNHMVRLHADIIEA 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071 16/84 (19%)
COG5048 198..>508 CDD:227381 59/203 (29%)
C2H2 Zn finger 221..241 CDD:275368 7/19 (37%)
C2H2 Zn finger 249..269 CDD:275368 9/19 (47%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
C2H2 Zn finger 305..327 CDD:275368 4/21 (19%)
C2H2 Zn finger 338..359 CDD:275368 6/20 (30%)
C2H2 Zn finger 367..384 CDD:275368 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368
C2H2 Zn finger 451..471 CDD:275368
C2H2 Zn finger 480..500 CDD:275368
C2H2 Zn finger 508..528 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..582 CDD:275368
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 15/83 (18%)
C2H2 Zn finger 234..255 CDD:275368 7/20 (35%)
C2H2 Zn finger 264..285 CDD:275368 9/20 (45%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 17/71 (24%)
C2H2 Zn finger 324..344 CDD:275368 4/21 (19%)
C2H2 Zn finger 354..374 CDD:275368 6/20 (30%)
zf-H2C2_2 366..389 CDD:290200 9/23 (39%)
C2H2 Zn finger 382..403 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.