DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and esg

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster


Alignment Length:554 Identity:102/554 - (18%)
Similarity:171/554 - (30%) Gaps:189/554 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 EDLEPAEEHQETETTKPTTTVSAETQPN--NTASDPIEIFV-----------------------D 146
            ||:...:.:.:....|.......|...|  ||.::|.::.|                       :
  Fly     5 EDMLVEKNYSKCPLKKRPVNYQFEAPQNHSNTPNEPQDLCVKKMEILEENPSEELINVSDCCEDE 69

  Fly   147 AVDIDEAEEEEEEEEQQQQYDEEVEEPITDESAPPQLTISYAC---------------------- 189
            .||:|..::|..|||     ||:|:   .|..:.|..|.:.|.                      
  Fly    70 GVDVDHTDDEHIEEE-----DEDVD---VDVDSDPNQTQAAALAAAAAVAAAAAASVVVPTPTYP 126

  Fly   190 KFCLRPQENYQLQQLLLEH---IN-ASH-------DPEQPYNCPECEARFQDAASRTVHLKSSHV 243
            |:   |..|:.:.....|.   || ..|       |...|.:..:............:|.::|.|
  Fly   127 KY---PWNNFHMSPYTAEFYRTINQQGHQILPLRGDLIAPSSPSDSLGSLSPPPHHYLHGRASSV 188

  Fly   244 EKQHACGVCGKKYGDRH-------------NLRHHVEKYHSETDFECALCEKRFYTRKSLNYHMK 295
            .......:..:..|.|.             :|..:...:|.......|..|..:|:.:|:     
  Fly   189 SPPMRSEIIHRPIGVRQHRFLPYPQMPGYPSLGGYTHTHHHHAPISPAYSENSYYSMRSM----- 248

  Fly   296 WHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIYRQHG 360
              .|:.  .|..|..|.|.:..::|.                        ::|.|      .|.|
  Fly   249 --TPES--SCSSSLPEDLSLKHKNLN------------------------LNLNT------SQPG 279

  Fly   361 GEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERSECMLCRQPFSSEPDLIHHMSAEHLQRP 425
            .:...|..:                                               ||.|.:...
  Fly   280 EQAAAKTGD-----------------------------------------------MSPETMPNA 297

  Fly   426 GAPIIANNKRVLQQKRERQYSGLFQCGSCSQRFNMKSALERHAAVH------SEKDRPHACPHCS 484
            .|            |:::.....:||..|.:.::..|.|.:|...|      ::..:..:|..|.
  Fly   298 SA------------KKDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCD 350

  Fly   485 KRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQHRLSHEVLEKNFKCNVCGRAYLFEKS 549
            |.:.....:|.||:||  ..|..|::|||||:..::|..|..:| ..||.|.|..|.||:....:
  Fly   351 KTYVSLGALKMHIRTH--TLPCKCNLCGKAFSRPWLLQGHIRTH-TGEKPFSCQHCHRAFADRSN 412

  Fly   550 LRLHQRTHTGKTYYKCDLCQERFVTHIKLKTHMQ 583
            ||.|.:||:....|.|..|.:.|.....|..|.:
  Fly   413 LRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKHSE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 50/339 (15%)
C2H2 Zn finger 221..241 CDD:275368 1/19 (5%)
C2H2 Zn finger 249..269 CDD:275368 3/32 (9%)
C2H2 Zn finger 277..297 CDD:275368 4/19 (21%)
C2H2 Zn finger 305..327 CDD:275368 5/21 (24%)
C2H2 Zn finger 338..359 CDD:275368 2/20 (10%)
C2H2 Zn finger 367..384 CDD:275368 0/16 (0%)
C2H2 Zn finger 400..420 CDD:275368 2/19 (11%)
C2H2 Zn finger 451..471 CDD:275368 5/19 (26%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
C2H2 Zn finger 508..528 CDD:275368 8/19 (42%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..582 CDD:275368 4/16 (25%)
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 6/21 (29%)
C2H2 Zn finger 311..331 CDD:275370 5/19 (26%)
zf-C2H2 344..366 CDD:278523 6/21 (29%)
C2H2 Zn finger 346..366 CDD:275368 6/19 (32%)
zf-C2H2 370..392 CDD:278523 8/21 (38%)
C2H2 Zn finger 372..392 CDD:275368 8/19 (42%)
zf-H2C2_2 385..408 CDD:290200 10/23 (43%)
zf-C2H2 398..420 CDD:278523 8/21 (38%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
C2H2 Zn finger 428..444 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.