DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and ZNF879

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001129588.1 Gene:ZNF879 / 345462 HGNCID:37273 Length:563 Species:Homo sapiens


Alignment Length:409 Identity:123/409 - (30%)
Similarity:172/409 - (42%) Gaps:59/409 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 YACKFCLRPQENYQLQQLLLEHINAS-----HDPEQPYNCPECEARFQDAASRTVHLKSSHVEKQ 246
            |.|..|         .::.|...:.|     |..|:.|.|.||...|..::|.|.||:....||.
Human   204 YKCNIC---------GKIFLHSSSLSKHQRIHTGEKLYKCKECRKAFSQSSSLTQHLRVHTGEKP 259

  Fly   247 HACGVCGKKYGDRHNLRHHVEKYHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCE 311
            :.|..|||.:....:|..|...:..|..::|..|.|.|....|||.|.:.|..::.:||..  |.
Human   260 YICSECGKAFSFTTSLIGHQRMHTGERPYKCKECGKTFKGSSSLNNHQRIHTGEKPYKCNE--CG 322

  Fly   312 RLFISQRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFAS 376
            |.|.....|:.|...|:|   .|...|..|||.|..:..|..| :|.|.||||:.|..|.:||:.
Human   323 RAFSQCSSLIQHHRIHTG---EKPYECTQCGKAFTSISRLSRH-HRIHTGEKPFHCNECGKVFSY 383

  Fly   377 YA----EKRIHMLERHRENLTAIERSECMLCRQPFSSEPDLIHHMSAEHLQRPGAPIIANNKRVL 437
            ::    .:|||         |..:...|..|.:.||....||.|......::|            
Human   384 HSALIIHQRIH---------TGEKPYACKECGKAFSQSSALIQHQRIHTGEKP------------ 427

  Fly   438 QQKRERQYSGLFQCGSCSQRFNMKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEK 502
                       ::|..|.:.|:..|.|..|..:|: .::|:.|..|.|.|.....:..|.|.|..
Human   428 -----------YKCNECGKAFSWISRLNIHHRIHT-GEKPYNCKECGKAFSSHSGVNTHRKIHTG 480

  Fly   503 EKPNVCDVCGKAFALKYVLTQHRLSHEVLEKNFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDL 567
            |||..|:.|.|||.....|.||:..| ..||.:.|.|||:|:....||..|.|.|||:..|||..
Human   481 EKPYKCNDCEKAFNQSSALIQHQRIH-TGEKPYNCKVCGKAFRQSSSLMTHMRIHTGEKPYKCKE 544

  Fly   568 CQERFVTHIKLKTHMQKAH 586
            |.:.|.....|..| |:.|
Human   545 CGKAFSQSSSLTNH-QRTH 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 88/318 (28%)
C2H2 Zn finger 221..241 CDD:275368 8/19 (42%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 8/19 (42%)
C2H2 Zn finger 305..327 CDD:275368 6/21 (29%)
C2H2 Zn finger 338..359 CDD:275368 8/20 (40%)
C2H2 Zn finger 367..384 CDD:275368 6/20 (30%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
C2H2 Zn finger 508..528 CDD:275368 8/19 (42%)
C2H2 Zn finger 537..557 CDD:275368 9/19 (47%)
C2H2 Zn finger 565..582 CDD:275368 4/16 (25%)
ZNF879NP_001129588.1 KRAB 14..74 CDD:214630
COG5048 202..558 CDD:227381 120/402 (30%)
C2H2 Zn finger 206..226 CDD:275368 4/28 (14%)
C2H2 Zn finger 234..254 CDD:275368 8/19 (42%)
C2H2 Zn finger 262..282 CDD:275368 6/19 (32%)
C2H2 Zn finger 290..310 CDD:275368 8/19 (42%)
C2H2 Zn finger 318..338 CDD:275368 6/21 (29%)
C2H2 Zn finger 346..366 CDD:275368 8/20 (40%)
C2H2 Zn finger 374..394 CDD:275368 5/19 (26%)
C2H2 Zn finger 402..422 CDD:275368 7/19 (37%)
C2H2 Zn finger 430..450 CDD:275368 6/19 (32%)
C2H2 Zn finger 458..478 CDD:275368 6/19 (32%)
C2H2 Zn finger 486..506 CDD:275368 8/19 (42%)
C2H2 Zn finger 514..534 CDD:275368 9/19 (47%)
C2H2 Zn finger 542..562 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.