DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and CG15436

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:371 Identity:96/371 - (25%)
Similarity:143/371 - (38%) Gaps:102/371 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 EEQQQQY----DEEVEEPITDESAPPQLTISYACKFCLRPQENYQLQQLLLEHINASHDPEQPYN 220
            ||..|.|    ||.:|:.:              |  .|..:|::::.:                 
  Fly    70 EESHQFYCRVRDEGIEDAL--------------C--ALLEEEDWEISE----------------- 101

  Fly   221 CPECEARFQDAASRTVHLKSSHVEKQHACGVCGKKYGDRHNLRHHVEKYHSETDFECALCEKRFY 285
              :.:||...|::.....||...:....|..|.|||..:.....|:..:.....|.|..|::.|.
  Fly   102 --DEDARIDSASAADDDGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFR 164

  Fly   286 TRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKT 350
            .|.:|..|||.||..:.::|.|  |.:.|..|..|..||.||:|....|   |..|.||||....
  Fly   165 LRVTLKAHMKTHNAAKPYECSH--CAKTFAQQSTLQSHERTHTGERPFK---CSQCSKTFIKSSD 224

  Fly   351 LRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERSECMLCRQPFSSEPDLIH 415
            ||.|| |.||.|:|:||:.||:.|.    ::.| |:.|..:.|.                     
  Fly   225 LRRHI-RTHGSERPFKCSKCTKTFT----RKFH-LDNHFRSHTG--------------------- 262

  Fly   416 HMSAEHLQRPGAPIIANNKRVLQQKRERQYSGLFQCGSCSQRFNMKSALERHAAVHSEKDRPHAC 480
                   :||                       |:|..|.:.|.||..|::|:.:|. .|||..|
  Fly   263 -------ERP-----------------------FKCSHCPKAFAMKQHLKQHSRLHL-PDRPFRC 296

  Fly   481 PHCSKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQHRL 526
            .||.|.|:.:..:|.|...|..|:...|..|...:..:..|.:|.|
  Fly   297 SHCPKTFRLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHIL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 81/309 (26%)
C2H2 Zn finger 221..241 CDD:275368 4/19 (21%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 8/19 (42%)
C2H2 Zn finger 305..327 CDD:275368 8/21 (38%)
C2H2 Zn finger 338..359 CDD:275368 11/20 (55%)
C2H2 Zn finger 367..384 CDD:275368 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 0/19 (0%)
C2H2 Zn finger 451..471 CDD:275368 7/19 (37%)
C2H2 Zn finger 480..500 CDD:275368 7/19 (37%)
C2H2 Zn finger 508..528 CDD:275368 5/19 (26%)
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..582 CDD:275368
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 4/7 (57%)
C2H2 Zn finger 128..148 CDD:275368 6/19 (32%)
C2H2 Zn finger 156..176 CDD:275368 8/19 (42%)
COG5048 <180..341 CDD:227381 62/223 (28%)
C2H2 Zn finger 184..204 CDD:275368 8/21 (38%)
zf-H2C2_2 197..219 CDD:290200 10/24 (42%)
C2H2 Zn finger 212..232 CDD:275368 11/20 (55%)
zf-H2C2_2 224..249 CDD:290200 14/29 (48%)
C2H2 Zn finger 240..260 CDD:275368 7/24 (29%)
zf-H2C2_2 252..276 CDD:290200 9/75 (12%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
C2H2 Zn finger 324..341 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2264
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.