DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and AgaP_AGAP012835

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_561485.2 Gene:AgaP_AGAP012835 / 3292645 VectorBaseID:AGAP012835 Length:244 Species:Anopheles gambiae


Alignment Length:257 Identity:55/257 - (21%)
Similarity:96/257 - (37%) Gaps:57/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ICSDCFTKFCSINAFRLAC------------------QEAQLK-----LSHIYDKIDASSLEDDE 103
            ||..|..|.....|:|..|                  ::::.|     ..|.|.::|.    |.|
Mosquito    17 ICEPCHNKLQKFTAYRYFCLSNDERFRELFSALCASERDSEAKPPSATFEHSYFRMDG----DSE 77

  Fly   104 IGQEDLEPAEEHQETETTKPTTTVSAETQPNNTASDPIEIFVDAVDIDEAEEEEEEEEQQQQYDE 168
            ..:|.:|..|..::..:.:.....||.|.|:     |.|..:...:::|.|..|:.::.::.|..
Mosquito    78 YPEEHVEMLEPTEQQHSDEGLNWWSATTPPS-----PSEAELSTEELEEFEPPEKPKKPRKPYVR 137

  Fly   169 EVEEPITDESAPPQLTISYACKFCLRPQENYQLQQLLLEHINASHDPEQPYNCPECEARFQDAAS 233
            ........:|:..:..:     :..||.:|...::|                |..| .:|  .|:
Mosquito   138 RATVGKEQDSSMKKQRV-----YKKRPNQNKLPKKL----------------CTVC-GKF--VAN 178

  Fly   234 RTVHLKSSHVEKQHACGVCGKKYGDRHNLRHHVEKYH-SETDFECALCEKRFYTRKSLNYHM 294
            ...||.|...|::.||..|...:.....|:.|||..| .:|...|.||::.|..:.|...||
Mosquito   179 LNHHLLSHTNERRFACTYCPGAFSRSSLLKVHVEAVHLKKTAKTCELCDRSFTHKSSYTIHM 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071 8/47 (17%)
COG5048 198..>508 CDD:227381 26/98 (27%)
C2H2 Zn finger 221..241 CDD:275368 6/19 (32%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 7/18 (39%)
C2H2 Zn finger 305..327 CDD:275368
C2H2 Zn finger 338..359 CDD:275368
C2H2 Zn finger 367..384 CDD:275368
C2H2 Zn finger 400..420 CDD:275368
C2H2 Zn finger 451..471 CDD:275368
C2H2 Zn finger 480..500 CDD:275368
C2H2 Zn finger 508..528 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..582 CDD:275368
AgaP_AGAP012835XP_561485.2 zf-AD <9..44 CDD:214871 7/26 (27%)
C2H2 Zn finger 169..186 CDD:275368 6/19 (32%)
C2H2 Zn finger 194..215 CDD:275368 6/20 (30%)
C2H2 Zn finger 223..240 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000098
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.