powered by:
Protein Alignment CG8301 and AgaP_AGAP012742
DIOPT Version :9
Sequence 1: | NP_649915.1 |
Gene: | CG8301 / 41160 |
FlyBaseID: | FBgn0037717 |
Length: | 607 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_561267.1 |
Gene: | AgaP_AGAP012742 / 3292205 |
VectorBaseID: | AGAP012742 |
Length: | 79 |
Species: | Anopheles gambiae |
Alignment Length: | 30 |
Identity: | 9/30 - (30%) |
Similarity: | 11/30 - (36%) |
Gaps: | 0/30 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 ICSDCFTKFCSINAFRLACQEAQLKLSHIY 91
:|.||..|.....|||..|.........:|
Mosquito 50 LCRDCAEKLKQSVAFRDNCLANSALFEQLY 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000098 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.