DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and CG11398

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:266 Identity:68/266 - (25%)
Similarity:104/266 - (39%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 HSETDFECALC--EKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATH---SG 329
            |:..|.|.:|.  |.:|......:.|.:..:|  .|.||.  |..||:::..|..|..||   .|
  Fly    17 HTYEDEELSLNTEELQFEELNERSQHQQGGSP--SFVCRR--CPALFLTREELAAHRPTHRYQGG 77

  Fly   330 TSSRKSEH-CGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLT 393
            ..:..||| |..||:.|.....|..|: ..|...:.|.|..|...|...:.:..|:...||:   
  Fly    78 QQTPASEHACDACGRVFQKHNALVDHM-NAHNDVRNYPCPECPARFVQRSNRECHLKNVHRK--- 138

  Fly   394 AIERSECML--CRQPFSSEPDLIHHMSAEHLQRPGAPIIANNKRVLQQKRERQYSGLFQCGSCSQ 456
             :....|..  |::.|....:...|:...|          .|:|.|            .|.:||.
  Fly   139 -VYLHSCPEPGCKKRFQQRRECDQHVKTVH----------QNERNL------------VCDTCSA 180

  Fly   457 RFNMKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVL 521
            ||:......:|.|.|... :.:.||.|.|.|.|.::...|:..|...|..:|.|||..:..:..|
  Fly   181 RFSHPVNYRKHLASHGSA-KSYGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQL 244

  Fly   522 TQHRLS 527
            .:|.|:
  Fly   245 IRHGLA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 61/245 (25%)
C2H2 Zn finger 221..241 CDD:275368
C2H2 Zn finger 249..269 CDD:275368
C2H2 Zn finger 277..297 CDD:275368 4/21 (19%)
C2H2 Zn finger 305..327 CDD:275368 7/21 (33%)
C2H2 Zn finger 338..359 CDD:275368 6/20 (30%)
C2H2 Zn finger 367..384 CDD:275368 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 4/21 (19%)
C2H2 Zn finger 451..471 CDD:275368 7/19 (37%)
C2H2 Zn finger 480..500 CDD:275368 7/19 (37%)
C2H2 Zn finger 508..528 CDD:275368 7/20 (35%)
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..582 CDD:275368
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 7/21 (33%)
C2H2 Zn finger 87..107 CDD:275368 6/20 (30%)
C2H2 Zn finger 115..136 CDD:275368 4/20 (20%)
C2H2 Zn finger 144..165 CDD:275368 4/20 (20%)
C2H2 Zn finger 175..195 CDD:275368 7/19 (37%)
C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..247 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.