DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and Zfp846

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_766507.2 Gene:Zfp846 / 244721 MGIID:1924012 Length:541 Species:Mus musculus


Alignment Length:513 Identity:145/513 - (28%)
Similarity:222/513 - (43%) Gaps:67/513 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SSLEDDEIGQEDLEPAEEHQETETT-------KPTTTVSAETQPNNTASDPI------EIFVDAV 148
            |.||::::.:|||:..|....|:.:       :..|:...:|..:::|.:..      |||    
Mouse    64 SWLEEEDLHREDLQEWEMPLGTQESPLHQDFLRGQTSSGIQTGRSHSAHELCYYTQCGEIF---- 124

  Fly   149 DIDEAEEEEEEEEQQQQYDEEVEEPIT----DESAPPQLTISYACKFCLRPQENYQLQQLLLEHI 209
                 .|....:...:.:.......:|    |.||......:|.||.|   .:.:.....|..|:
Mouse   125 -----SEHSYFKTHVKTHSAWNTGHLTHSDHDVSAQVHTIKTYPCKIC---GKAFGRSSNLNRHL 181

  Fly   210 NASHDPEQPYNCPECEARFQDAASRTVHLKSSHVEKQHACGVCGKKYGDRHNLRHHVEKYHSETD 274
            . ||..|:||.|.||...|...:....|.::...||.:.|..|||.:..|..|..|:..:.||..
Mouse   182 R-SHTGEKPYECKECGKAFTTYSRLVEHFRTHTGEKPYKCKDCGKAFAKRSGLITHISTHASEKP 245

  Fly   275 FECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEA-THSGTSSRKSEHC 338
            |.|..|.|.|.:...|:.|::.|:.:|.:.|:.  |.|.|::..:|..|.. ||||   .:...|
Mouse   246 FACKECGKAFASSPRLSQHIRIHSGERPYICKE--CGRAFLTSSYLRNHVGRTHSG---ERPYIC 305

  Fly   339 GFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERSECMLC 403
            |.|||.|.....||.|: |.|.||:||.|..|.:.|.:.:....|:.:.|...:..|    |..|
Mouse   306 GECGKAFHSYSNLRRHV-RTHSGERPYICKECGKAFLNSSYLHNHIRKTHSGEMPHI----CGEC 365

  Fly   404 RQPFSSEPDLIHHMSAEHLQRPGAPIIANNKRVLQQKRERQYSGLFQCGSCSQRFNMKSALERHA 468
            .:.|.:...|..|:.....:||..                       |..|.:.|...|.|.:|.
Mouse   366 GKVFHASSYLRRHLRTHSGERPCI-----------------------CKECGKAFLNSSYLRKHL 407

  Fly   469 AVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQHRLSHEVLEK 533
            .:|: .|:|:.|..|.|.::|...:..|:|||..|||..||||||:|.....|.:|...| ...|
Mouse   408 TIHT-GDKPYECKECGKAYRRYNLLHDHLKTHAVEKPFECDVCGKSFQYFSYLNKHIRIH-TGTK 470

  Fly   534 NFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDLCQERFVTHIKLKTHMQKAHAASQP 591
            .:||..||:.:....|...|.|||||:..|:|..|::.|.:...|..|: |.||..:|
Mouse   471 PYKCKYCGKDFTTSSSRTEHIRTHTGERPYECSECEKTFTSSSNLIHHV-KIHAREKP 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 90/310 (29%)
C2H2 Zn finger 221..241 CDD:275368 5/19 (26%)
C2H2 Zn finger 249..269 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 305..327 CDD:275368 6/22 (27%)
C2H2 Zn finger 338..359 CDD:275368 10/20 (50%)
C2H2 Zn finger 367..384 CDD:275368 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
C2H2 Zn finger 508..528 CDD:275368 9/19 (47%)
C2H2 Zn finger 537..557 CDD:275368 6/19 (32%)
C2H2 Zn finger 565..582 CDD:275368 4/16 (25%)
Zfp846NP_766507.2 KRAB 14..70 CDD:214630 3/5 (60%)
KRAB 14..52 CDD:279668
C2H2 Zn finger 118..137 CDD:275368 4/27 (15%)
COG5048 160..528 CDD:227381 126/408 (31%)
zf-C2H2 162..184 CDD:278523 6/25 (24%)
C2H2 Zn finger 164..184 CDD:275368 5/23 (22%)
zf-H2C2_2 176..201 CDD:290200 11/25 (44%)
C2H2 Zn finger 192..212 CDD:275368 5/19 (26%)
zf-H2C2_2 205..228 CDD:290200 7/22 (32%)
C2H2 Zn finger 220..240 CDD:275368 7/19 (37%)
C2H2 Zn finger 248..268 CDD:275368 6/19 (32%)
C2H2 Zn finger 276..297 CDD:275368 6/22 (27%)
C2H2 Zn finger 305..325 CDD:275368 10/20 (50%)
zf-H2C2_2 317..342 CDD:290200 12/25 (48%)
C2H2 Zn finger 333..354 CDD:275368 4/20 (20%)
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 374..399 CDD:290200 7/47 (15%)
C2H2 Zn finger 390..410 CDD:275368 6/19 (32%)
zf-H2C2_2 402..427 CDD:290200 8/25 (32%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
C2H2 Zn finger 446..466 CDD:275368 9/19 (47%)
zf-H2C2_2 458..483 CDD:290200 8/25 (32%)
C2H2 Zn finger 474..494 CDD:275368 6/19 (32%)
zf-H2C2_2 489..511 CDD:290200 10/21 (48%)
C2H2 Zn finger 502..522 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.