DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and Zfp92

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_033592.2 Gene:Zfp92 / 22754 MGIID:108094 Length:488 Species:Mus musculus


Alignment Length:397 Identity:96/397 - (24%)
Similarity:148/397 - (37%) Gaps:101/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LLEHINASHDPEQPYNC-PECEARFQDAASRTVHLKSSHVEKQHACGVCGKKYGDRHNLRHHVEK 268
            ||.:.:.|....:|::. |....|:|         .|...:|::.|..|||.:....||..|...
Mouse   107 LLRNTSRSSLQRRPHDFRPNPIVRYQ---------HSRIADKRYLCQQCGKSFSRSFNLIKHRII 162

  Fly   269 YHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTSSR 333
            :..|..:||:.|.|:|....:|..|.:.|:.|:.::|  ..|.:.|....:|:.|:..|   ||.
Mouse   163 HSREKPYECSECGKQFQRSLALLEHQRIHSGDKPYEC--GECGKTFTRSSNLVKHQVIH---SSE 222

  Fly   334 KSEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAIERS 398
            ....|..|||.|.....|..|. |.|.||:|::|..|.:.                         
Mouse   223 MPFVCRMCGKVFRRSFALLEHT-RIHSGERPFECTECGKA------------------------- 261

  Fly   399 ECMLCRQPFSSEPDLIHHMSAEHLQRPGAPIIANNKRVLQQKRERQYSGLFQCGSCSQRFNMKSA 463
                    ||...:||.|......|:|                       :.|..|.:.|...|.
Mouse   262 --------FSRSSNLIEHQRIHSGQKP-----------------------YICKECGKAFKGVSQ 295

  Fly   464 LERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQHRLSH 528
            |..|..:| ..|:|..|....|.|:....:..|.:.|..|||..|..||:||..:..|.:|::.|
Mouse   296 LIHHQLIH-RGDKPFTCHEYGKAFRGLSGLSQHQRVHRGEKPYECSECGRAFGRRANLFKHQVVH 359

  Fly   529 EVLEKNFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDLCQERFVTHIKLKTHMQKAHAASQPHS 593
                               ..:||..||. ||.:      |.:.:.|:: ..|.|:...|.:..|
Mouse   360 -------------------GGVRLQHRTR-GKGF------QRKLLEHLR-DLHGQQPQEAGEGSS 397

  Fly   594 AD-QPLD 599
            |: ||:|
Mouse   398 AEPQPID 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 72/303 (24%)
C2H2 Zn finger 221..241 CDD:275368 3/20 (15%)
C2H2 Zn finger 249..269 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 305..327 CDD:275368 5/21 (24%)
C2H2 Zn finger 338..359 CDD:275368 8/20 (40%)
C2H2 Zn finger 367..384 CDD:275368 2/16 (13%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 4/19 (21%)
C2H2 Zn finger 508..528 CDD:275368 7/19 (37%)
C2H2 Zn finger 537..557 CDD:275368 3/19 (16%)
C2H2 Zn finger 565..582 CDD:275368 2/16 (13%)
Zfp92NP_033592.2 KRAB 14..74 CDD:214630
COG5048 <134..299 CDD:227381 53/226 (23%)
C2H2 Zn finger 143..163 CDD:275368 7/19 (37%)
C2H2 Zn finger 171..191 CDD:275368 6/19 (32%)
C2H2 Zn finger 199..219 CDD:275368 5/21 (24%)
C2H2 Zn finger 227..247 CDD:275368 8/20 (40%)
C2H2 Zn finger 255..275 CDD:275368 7/52 (13%)
C2H2 Zn finger 283..303 CDD:275368 6/19 (32%)
C2H2 Zn finger 311..331 CDD:275368 4/19 (21%)
zf-H2C2_2 324..348 CDD:372612 10/23 (43%)
C2H2 Zn finger 339..359 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..408 7/18 (39%)
C2H2 Zn finger 412..432 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 435..488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.