DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and Zfp59

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_035892.2 Gene:Zfp59 / 22717 MGIID:99206 Length:653 Species:Mus musculus


Alignment Length:475 Identity:133/475 - (28%)
Similarity:201/475 - (42%) Gaps:57/475 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 EEEEQQQQYDEEVEEPITDESAPPQLTISYACKFCLRPQENYQLQQLLLEHINASHDPEQPYNCP 222
            :.:..||..::|...|.|.::........|.||.|   .:.:..:..|.:| .:.|..|:||.|.
Mouse   143 QSDAGQQITNKEGVPPHTCQTLAHNTEKPYECKEC---GKCFGCRSTLTQH-QSVHTGEKPYECK 203

  Fly   223 ECEARFQDAASRTVHLKSSHVEK-----------QH-----------------ACGVCGKKYGDR 259
            ||...|:.....|.|.|....||           ||                 ||..|||.:...
Mouse   204 ECGKAFRLPQQLTRHQKCHSGEKPFSHNEGRQAFQHPNLLKYPKAIHTGAKAFACRECGKSFNRV 268

  Fly   260 HNLRHHVEKYHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHE 324
            .:|..|...:.....:||..|.|.|...:|...|.|.|:.:|.|:|:  .|.:.||...||..|:
Mouse   269 SSLVEHGLIHADVKPYECNECGKAFKRHRSFVRHQKIHSGERPFQCK--DCGKGFIVLAHLTRHQ 331

  Fly   325 ATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHM-LERH 388
            ::|   |..|...|..|||.|...:.|..| .|.|.||||::|..|...|      |:.: |..|
Mouse   332 SSH---SEEKPFECEECGKKFRTARHLVKH-QRIHSGEKPFECNVCGSAF------RLQLYLSEH 386

  Fly   389 RENLTAIERSECMLCRQPFSSEPDLIHHMSAEHLQRP------GAPIIANNKRVLQQKRERQYSG 447
            ::.....:..||.:|.:.|..:..|..|:.....:.|      |:..  .||..|.:.......|
Mouse   387 QKTHMEEKYLECNVCGKAFRLQVYLSEHLKTHTEENPFKCKLCGSAF--PNKYQLNKHLTVHTDG 449

  Fly   448 L-FQCGSCSQRFNMKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVC 511
            . :||..|.:.|..:|.|..|.::|:.| :|..|..|.|.|:....:..|.|:|..|:|..|..|
Mouse   450 KPYQCKECGKCFRQRSKLTEHESIHTGK-KPFQCEECGKFFRLNTLLIHHQKSHSGERPFECKEC 513

  Fly   512 GKAFALKYVLTQHRLSHEVLEKNFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDLCQERFVTHI 576
            ||||.|...|..|::.| ..::.|:|.|||:::..|.:|..|...|.|...|:|..|.:.|: |.
Mouse   514 GKAFLLPSQLNSHKIVH-TSKRPFECKVCGKSFKRESNLIQHGAVHAGVKSYECSECGKGFI-HR 576

  Fly   577 KLKTHMQKAHAASQPHSADQ 596
            ....|.:|.|:..:|....:
Mouse   577 SSLFHHRKIHSDEKPFKCQE 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 95/345 (28%)
C2H2 Zn finger 221..241 CDD:275368 7/19 (37%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
C2H2 Zn finger 305..327 CDD:275368 7/21 (33%)
C2H2 Zn finger 338..359 CDD:275368 8/20 (40%)
C2H2 Zn finger 367..384 CDD:275368 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
C2H2 Zn finger 508..528 CDD:275368 9/19 (47%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..582 CDD:275368 4/16 (25%)
Zfp59NP_035892.2 KRAB 14..75 CDD:214630
COG5048 167..554 CDD:227381 116/406 (29%)
C2H2 Zn finger 174..194 CDD:275368 5/23 (22%)
C2H2 Zn finger 202..222 CDD:275368 7/19 (37%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 7/21 (33%)
C2H2 Zn finger 342..362 CDD:275368 8/20 (40%)
C2H2 Zn finger 370..390 CDD:275368 6/25 (24%)
C2H2 Zn finger 398..418 CDD:275368 5/19 (26%)
C2H2 Zn finger 426..446 CDD:275368 4/21 (19%)
C2H2 Zn finger 454..474 CDD:275368 6/19 (32%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 9/19 (47%)
C2H2 Zn finger 538..558 CDD:275368 7/19 (37%)
C2H2 Zn finger 566..586 CDD:275368 6/20 (30%)
C2H2 Zn finger 594..614 CDD:275368 0/3 (0%)
C2H2 Zn finger 622..642 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.