DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and zfp-2

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_496055.1 Gene:zfp-2 / 174505 WormBaseID:WBGene00009448 Length:422 Species:Caenorhabditis elegans


Alignment Length:466 Identity:94/466 - (20%)
Similarity:160/466 - (34%) Gaps:171/466 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QEAQLKLSHIYDKIDASSLEDDEIGQEDLEPAEEHQ---ETETTKPTTTVSAETQPNNTASDPIE 142
            |..||..|..:.:.....::    |:..:|..:.|.   .:.:.:|:|:    :.|::....|:.
 Worm    64 QREQLSTSKDFGEQQIVEMD----GEFSIEGTDMHAIPCTSSSMQPSTS----SNPSSGEHQPVP 120

  Fly   143 IFVDAVDIDE---------AEEEEEEEEQQQQYDEEVEEPITDESAPPQLTISYACKFCLRPQEN 198
            :...|:.|.:         |||..|                    ||            |..|::
 Worm   121 LRRMAIKIGQRVLRFKVISAEEAPE--------------------AP------------LDTQDS 153

  Fly   199 YQLQQLLLEHINASHDPEQPYNCPECEARFQDAASRTVHLKSSHVEKQHACGVCGKKYGDRHNLR 263
            :         ||   || :|...|:..|..                  :.|..|...:|::...:
 Worm   154 W---------IN---DP-KPVTTPKALAGL------------------YRCTNCKTYFGNKEVYQ 187

  Fly   264 HHVEKYHSET-DFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATH 327
            .|:::.|.:. .|.|..|..||..:.|:.:|:|.|:                     |:      
 Worm   188 RHIQEVHGDARPFRCFNCGMRFANKTSMTHHLKDHS---------------------LL------ 225

  Fly   328 SGTSSRKSEHCGFCGKTFIHLKTLRWHIYRQHGGEKP-YKCANCTEVFASYAEKRIHMLERHREN 391
                                               || :.|..|..:|:....|..|    |:.:
 Worm   226 -----------------------------------KPMFSCDYCPRIFSKLESKTRH----HKMH 251

  Fly   392 LTAIERSECMLCRQPFSSEPDLIHHMSAEHLQR-----PGAPIIANNKRVLQQKRERQYSGLFQC 451
            .|   ||.|..|.:.|::|..|.||.|..|...     |...::.|.|           |..:.|
 Worm   252 FT---RSTCQTCMRFFTTEDALRHHQSTAHPATFDSGPPPEDLLPNGK-----------SARYSC 302

  Fly   452 GSCSQRFNMKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFA 516
            ..|:.||:.|..:..|..:|: .::|::|.:|.|.|.::|.:..||:||.||.|..|..|.|.|.
 Worm   303 SYCNLRFHFKKDMLVHERIHT-GEKPYSCGYCMKSFAQSQALTAHIRTHTKELPYGCGKCDKRFR 366

  Fly   517 LKYVLTQHRLS 527
            ....|.:|.|:
 Worm   367 DNSCLRKHELA 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071 3/5 (60%)
COG5048 198..>508 CDD:227381 66/316 (21%)
C2H2 Zn finger 221..241 CDD:275368 2/19 (11%)
C2H2 Zn finger 249..269 CDD:275368 4/19 (21%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
C2H2 Zn finger 305..327 CDD:275368 1/21 (5%)
C2H2 Zn finger 338..359 CDD:275368 0/20 (0%)
C2H2 Zn finger 367..384 CDD:275368 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 8/19 (42%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 7/19 (37%)
C2H2 Zn finger 508..528 CDD:275368 7/20 (35%)
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..582 CDD:275368
zfp-2NP_496055.1 C2H2 Zn finger 173..194 CDD:275368 4/20 (20%)
C2H2 Zn finger 202..222 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..251 CDD:275368 6/23 (26%)
COG5048 <251..>358 CDD:227381 36/121 (30%)
C2H2 Zn finger 257..278 CDD:275368 8/20 (40%)
C2H2 Zn finger 302..322 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
C2H2 Zn finger 358..374 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.