DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and ZFP92

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001129745.1 Gene:ZFP92 / 139735 HGNCID:12865 Length:416 Species:Homo sapiens


Alignment Length:296 Identity:91/296 - (30%)
Similarity:121/296 - (40%) Gaps:65/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 DRQFKCRHSGCERLFISQRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIYRQHGGEKP 364
            ::::.|:.  |.:.|....:|:.|...|||   .|...|..|||.|.....|..| .|.|.||||
Human   149 EKRYLCQQ--CGKAFSRSSNLIKHRIIHSG---EKPYACPECGKLFRRSFALLEH-QRIHSGEKP 207

  Fly   365 YKCANCTEVFASYAEKRIHMLERHRENLTAIERSECMLCRQPFSSEPDLIHHMSAEHLQRPGAPI 429
            |.|..|::.|.                     ||.            :||.|......:||    
Human   208 YACPECSKTFT---------------------RSS------------NLIKHQVIHSGERP---- 235

  Fly   430 IANNKRVLQQKRERQYSGLFQCGSCSQRFNMKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMK 494
                               |.||.|.:.|....||..||.||| .:||:|||.|.|.|.|:.::.
Human   236 -------------------FACGDCGKLFRRSFALLEHARVHS-GERPYACPECGKAFSRSSNLI 280

  Fly   495 WHIKTHEKEKPNVCDVCGKAFALKYVLTQHRLSHEVLEKNFKCNVCGRAYLFEKSLRLHQRTHTG 559
            .|.:||..|||..|..|.|||.....|..|:.||.. |:.|.|..||:|:.....|..|:|.|:|
Human   281 EHQRTHRGEKPYACGQCAKAFKGVSQLIHHQRSHSG-ERPFACRECGKAFRGRSGLSQHRRVHSG 344

  Fly   560 KTYYKCDLCQERFVTHIKLKTHMQKAHAASQPHSAD 595
            :..|:|..|.:.|.....|..| |..|.|.:|..|:
Human   345 EKPYECSDCGKAFGRRANLFKH-QAVHGARRPAKAE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 60/207 (29%)
C2H2 Zn finger 221..241 CDD:275368
C2H2 Zn finger 249..269 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 305..327 CDD:275368 5/21 (24%)
C2H2 Zn finger 338..359 CDD:275368 8/20 (40%)
C2H2 Zn finger 367..384 CDD:275368 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 3/19 (16%)
C2H2 Zn finger 451..471 CDD:275368 8/19 (42%)
C2H2 Zn finger 480..500 CDD:275368 7/19 (37%)
C2H2 Zn finger 508..528 CDD:275368 7/19 (37%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..582 CDD:275368 4/16 (25%)
ZFP92NP_001129745.1 KRAB 14..74 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..125
COG5048 <145..286 CDD:227381 55/199 (28%)
C2H2 Zn finger 154..174 CDD:275368 5/21 (24%)
C2H2 Zn finger 182..202 CDD:275368 8/20 (40%)
C2H2 Zn finger 210..230 CDD:275368 8/52 (15%)
C2H2 Zn finger 238..258 CDD:275368 8/19 (42%)
COG5048 262..>315 CDD:227381 23/52 (44%)
C2H2 Zn finger 266..286 CDD:275368 7/19 (37%)
C2H2 Zn finger 294..314 CDD:275368 7/19 (37%)
C2H2 Zn finger 322..342 CDD:275368 7/19 (37%)
zf-H2C2_2 335..359 CDD:404364 9/23 (39%)
C2H2 Zn finger 350..370 CDD:275368 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..416 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.