DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8301 and AgaP_AGAP012546

DIOPT Version :9

Sequence 1:	NP_649915.1	Gene:	CG8301 / 41160	FlyBaseID:	FBgn0037717	Length:	607	Species:	Drosophila melanogaster
Sequence 2:	XP_306729.2	Gene:	AgaP_AGAP012546 / 1268171	VectorBaseID:	AGAP012546	Length:	197	Species:	Anopheles gambiae

Alignment Length:	128	Identity:	39/128 - (30%)
Similarity:	58/128 - (45%)	Gaps:	10/128 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   437 LQQKRERQYSGLFQCGSCSQRFNMKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHI-KTH 500
            |.|:|.|.......|..|..   :.:.|:.|...|.: :|...||||...|:...:::.|| :.|
Mosquito    65 LLQERPRVKRKRHLCDECGA---LTNHLKSHVRYHRD-ERLEVCPHCPATFRHVSNLRGHIQQIH 125

  Fly   501 EKEKPNVCDVCGKAFALKYVLTQHRLSHEVLEKNFKCNVCGRA-----YLFEKSLRLHQRTHT 558
            .|:....|::|||.|........|.|:|....|.|:|..||::     ||.:...|||..|.|
Mosquito   126 VKKICKTCEICGKGFIHHKTYRYHMLNHANEGKRFECKDCGKSFSNEIYLRDHYNRLHNITKT 188

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8301	NP_649915.1	zf-AD	3..87	CDD:285071
		COG5048	198..>508	CDD:227381	19/71 (27%)
		C2H2 Zn finger	221..241	CDD:275368
		C2H2 Zn finger	249..269	CDD:275368
		C2H2 Zn finger	277..297	CDD:275368
		C2H2 Zn finger	305..327	CDD:275368
		C2H2 Zn finger	338..359	CDD:275368
		C2H2 Zn finger	367..384	CDD:275368
		C2H2 Zn finger	400..420	CDD:275368
		C2H2 Zn finger	451..471	CDD:275368	4/19 (21%)
		C2H2 Zn finger	480..500	CDD:275368	7/20 (35%)
		C2H2 Zn finger	508..528	CDD:275368	7/19 (37%)
		C2H2 Zn finger	537..557	CDD:275368	8/24 (33%)
		C2H2 Zn finger	565..582	CDD:275368
AgaP_AGAP012546	XP_306729.2	C2H2 Zn finger	79..96	CDD:275368	4/19 (21%)
		C2H2 Zn finger	104..125	CDD:275368	7/20 (35%)
		C2H2 Zn finger	133..153	CDD:275368	7/19 (37%)
		C2H2 Zn finger	162..183	CDD:275368	6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000098
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000