DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8301 and AgaP_AGAP012602

DIOPT Version :9

Sequence 1:	NP_649915.1	Gene:	CG8301 / 41160	FlyBaseID:	FBgn0037717	Length:	607	Species:	Drosophila melanogaster
Sequence 2:	XP_306233.4	Gene:	AgaP_AGAP012602 / 1267675	VectorBaseID:	AGAP012602	Length:	91	Species:	Anopheles gambiae

Alignment Length:	80	Identity:	26/80 - (32%)
Similarity:	35/80 - (43%)	Gaps:	6/80 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   488 KRAQDMKWHI-KTHEKEKPNVCDVCGKAFALKYVLTQHRLSHEVLEKNFKCNVCGRA-----YLF 546
            |:..::..|| :.|.|.....|.:|||.|........|.|:||...|.|.|..|.:.     ||.
Mosquito     2 KQKNNISQHILQVHYKAICRTCKICGKGFVHHKTYRYHMLTHEGEGKRFACQDCSKTFPNAIYLR 66

  Fly   547 EKSLRLHQRTHTGKT 561
            :...|:|....||||
Mosquito    67 DHFNRIHNAARTGKT 81

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8301	NP_649915.1	zf-AD	3..87	CDD:285071
		COG5048	198..>508	CDD:227381	5/20 (25%)
		C2H2 Zn finger	221..241	CDD:275368
		C2H2 Zn finger	249..269	CDD:275368
		C2H2 Zn finger	277..297	CDD:275368
		C2H2 Zn finger	305..327	CDD:275368
		C2H2 Zn finger	338..359	CDD:275368
		C2H2 Zn finger	367..384	CDD:275368
		C2H2 Zn finger	400..420	CDD:275368
		C2H2 Zn finger	451..471	CDD:275368
		C2H2 Zn finger	480..500	CDD:275368	3/12 (25%)
		C2H2 Zn finger	508..528	CDD:275368	7/19 (37%)
		C2H2 Zn finger	537..557	CDD:275368	6/24 (25%)
		C2H2 Zn finger	565..582	CDD:275368
AgaP_AGAP012602	XP_306233.4	C2H2 Zn finger	23..43	CDD:275368	7/19 (37%)
AgaP_AGAP012602	XP_306233.4	C2H2 Zn finger	52..73	CDD:275368	5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000098
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000