DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and AgaP_AGAP012602

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_306233.4 Gene:AgaP_AGAP012602 / 1267675 VectorBaseID:AGAP012602 Length:91 Species:Anopheles gambiae


Alignment Length:80 Identity:26/80 - (32%)
Similarity:35/80 - (43%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 KRAQDMKWHI-KTHEKEKPNVCDVCGKAFALKYVLTQHRLSHEVLEKNFKCNVCGRA-----YLF 546
            |:..::..|| :.|.|.....|.:|||.|........|.|:||...|.|.|..|.:.     ||.
Mosquito     2 KQKNNISQHILQVHYKAICRTCKICGKGFVHHKTYRYHMLTHEGEGKRFACQDCSKTFPNAIYLR 66

  Fly   547 EKSLRLHQRTHTGKT 561
            :...|:|....||||
Mosquito    67 DHFNRIHNAARTGKT 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 5/20 (25%)
C2H2 Zn finger 221..241 CDD:275368
C2H2 Zn finger 249..269 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 305..327 CDD:275368
C2H2 Zn finger 338..359 CDD:275368
C2H2 Zn finger 367..384 CDD:275368
C2H2 Zn finger 400..420 CDD:275368
C2H2 Zn finger 451..471 CDD:275368
C2H2 Zn finger 480..500 CDD:275368 3/12 (25%)
C2H2 Zn finger 508..528 CDD:275368 7/19 (37%)
C2H2 Zn finger 537..557 CDD:275368 6/24 (25%)
C2H2 Zn finger 565..582 CDD:275368
AgaP_AGAP012602XP_306233.4 C2H2 Zn finger 23..43 CDD:275368 7/19 (37%)
C2H2 Zn finger 52..73 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000098
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.