DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and ZNF837

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_612475.1 Gene:ZNF837 / 116412 HGNCID:25164 Length:531 Species:Homo sapiens


Alignment Length:435 Identity:121/435 - (27%)
Similarity:181/435 - (41%) Gaps:93/435 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 PPQLTISYACKFCLRPQENYQLQQLLLEHINASHDPEQP-YNCPECEARFQDAASRTVHLKSSHV 243
            ||      .|..|....:|:...||...|.:..  |.|| ...|.| .|.....||.   ::..|
Human   142 PP------VCDPCPERIQNHPRTQLCEVHTDCW--PCQPGTGAPTC-PRTPKPTSRG---RNPLV 194

  Fly   244 EKQHACGVCGKKYGDRHNLRHHVEKYH-SETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRH 307
            |:..|| .||:.:..| .||...|:.. :|....||.|.|||             .|::|.:...
Human   195 EQPRAC-ACGEAFAWR-ALRIPQERLQATEEPRPCARCGKRF-------------RPNQQQQAGK 244

  Fly   308 SGCERLFISQRHLMCHEATHSGTSSR-----------KSEHCGFCGKTFIHLKTLRWHIYRQHGG 361
            |          ..:|.|.   |.:||           :...|..|||.|....:|..| .|.|.|
Human   245 S----------PPVCPEC---GQTSRPRPIVPDPPAQRLYACDECGKAFTRTSSLLQH-QRIHTG 295

  Fly   362 EKPYKCANCTEVFAS----YAEKRIHMLERHRENLTAIERSECMLCRQPFSSEPDLIHHMSAEHL 422
            |:||:||.|.:.|..    |..::.|..||||..        .:|.|:.|               
Human   296 ERPYECAECGKAFVRCSGLYRHQKTHSAERHRRG--------PVLARRAF--------------- 337

  Fly   423 QRPGAPIIANNKRVLQQKRERQYSGL----FQCGSCSQRFNMKSALERHAAVHSEKDRPHACPHC 483
             |.|.|...:    ..::..|:.||.    ::|..|::.|.:.|.|..|..||: .::|:|||.|
Human   338 -RLGCPPCGD----YSERSPRRGSGAGEKPYECADCAKAFGLFSHLVEHRRVHT-GEKPYACPEC 396

  Fly   484 SKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQHRLSHEVLEKNFKCNVCGRAYLFEK 548
            .|.|.:..::..|.:||...||..|.:|.|||..:..|.||:.:| ..|:.:.|:.||:.:....
Human   397 GKAFNQRSNLSRHQRTHSSAKPYACPLCEKAFKGRSGLVQHQRAH-TGERPYGCSECGKTFRGCS 460

  Fly   549 SLRLHQRTHTGKTYYKCDLCQERFVTHIKLKTHMQKAHAASQPHS 593
            .||.|:|.|:|:..|.|..|.:.||.:..|..|: :.|...:|::
Human   461 ELRQHERLHSGEKPYICRDCGKAFVRNCSLVRHL-RTHTGERPYA 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 89/330 (27%)
C2H2 Zn finger 221..241 CDD:275368 5/19 (26%)
C2H2 Zn finger 249..269 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 305..327 CDD:275368 3/21 (14%)
C2H2 Zn finger 338..359 CDD:275368 8/20 (40%)
C2H2 Zn finger 367..384 CDD:275368 5/20 (25%)
C2H2 Zn finger 400..420 CDD:275368 3/19 (16%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 6/19 (32%)
C2H2 Zn finger 508..528 CDD:275368 8/19 (42%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..582 CDD:275368 5/16 (31%)
ZNF837NP_612475.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..101
DNA_pol3_gamma3 <3..>265 CDD:331207 41/162 (25%)
C2H2 Zn finger 273..293 CDD:275368 8/20 (40%)
COG5048 <276..437 CDD:227381 57/190 (30%)
COG5048 <361..521 CDD:227381 48/147 (33%)
C2H2 Zn finger 365..385 CDD:275368 6/19 (32%)
C2H2 Zn finger 393..413 CDD:275368 6/19 (32%)
C2H2 Zn finger 421..441 CDD:275368 8/19 (42%)
C2H2 Zn finger 449..469 CDD:275368 7/19 (37%)
C2H2 Zn finger 477..497 CDD:275368 6/20 (30%)
C2H2 Zn finger 505..525 CDD:275368 121/435 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.