DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and LOC108348302

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_017455832.1 Gene:LOC108348302 / 108348302 RGDID:11429468 Length:520 Species:Rattus norvegicus


Alignment Length:526 Identity:138/526 - (26%)
Similarity:209/526 - (39%) Gaps:75/526 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 IDASSLEDDEI--GQED---LEPAEEH----QETETTKPTTTVSAETQPNNTASD-----PIEIF 144
            :|..|.||..:  .||:   |:|::::    ...||.:....:..:.:..|...|     .|:..
  Rat     1 MDLVSFEDVAVHFTQEEWALLDPSQKNLYRDVMLETCRSLAAIGYKWEEQNVEDDCKNVGRIQRH 65

  Fly   145 VDAVDIDEAE--EEEEEEEQQQQYDEEVEEPITDESAPPQLTISYACKFCLR----PQENYQLQQ 203
            |    |.::|  .||:|....:.||......|...:....:.....|:.||:    |..      
  Rat    66 V----ISDSEYLPEEQEGYGSKPYDSSSLPSIQGYTGAHTVNGPCECEVCLKSFGFPST------ 120

  Fly   204 LLLEHINASHDPEQPYN-C--PECEARFQDAASRTVHLKSSHVEKQHACGVCGKKYGDRHNLRHH 265
                 ....|.|....| |  .||.......:|...|..:..:.|.::|..|||......:|:.|
  Rat   121 -----FGMYHQPHSGQNFCDYKECGKASVYHSSLYTHGGTHSIRKCYSCNQCGKVLSSSSSLQRH 180

  Fly   266 VEKYHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGT 330
            ...:..|..::|..|.|...:..||..|.:.|..:|.:||:.  |.:.|.....|..||..|:| 
  Rat   181 ERIHTGERPYKCQQCGKALSSSTSLQRHERIHTGERPYKCQQ--CGKAFRCHSALQLHERIHTG- 242

  Fly   331 SSRKSEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHMLERHRENLTAI 395
              .|...|..|||.|.....||.| .|.|.|||||:|..|.:.|........|.:....|..   
  Rat   243 --EKPYECQQCGKAFTCHSYLRLH-ERTHTGEKPYECKQCGKAFRCQTSYHRHKIIHGGETF--- 301

  Fly   396 ERSECMLCRQPFSSEPDLIHHMSAEHLQRPGAPIIANNKRVLQQKRERQYSGLFQCGSCSQRFNM 460
              .||..|.:.|.....|..|......:||                       ::|..|.:.|..
  Rat   302 --YECKQCSRLFIYPSLLQMHERTHTSERP-----------------------YKCKECGKSFLY 341

  Fly   461 KSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVCGKAFALKYVLTQHR 525
            .|.|:.|...|: .::|:.|..|...|:....::.|.:||..|||..|..|||||.....|..|.
  Rat   342 PSLLQMHERTHT-GEKPYECKQCGTAFRHHSSLRLHERTHTGEKPYECQQCGKAFTRHTSLRLHE 405

  Fly   526 LSHEVLEKNFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDLCQERFVTHIKLKTHMQKAHAASQ 590
            ::| ..||.:||..||:|:....|||||.|.|:|:..|:|..|.:.|:.:..|:.| ::.|...:
  Rat   406 ITH-TGEKPYKCKECGKAFRHHSSLRLHGRNHSGEKPYECKQCDKAFIRYSYLRLH-ERTHTGEK 468

  Fly   591 PHSADQ 596
            |:...|
  Rat   469 PYECKQ 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 79/312 (25%)
C2H2 Zn finger 221..241 CDD:275368 5/21 (24%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 305..327 CDD:275368 6/21 (29%)
C2H2 Zn finger 338..359 CDD:275368 9/20 (45%)
C2H2 Zn finger 367..384 CDD:275368 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 4/19 (21%)
C2H2 Zn finger 508..528 CDD:275368 8/19 (42%)
C2H2 Zn finger 537..557 CDD:275368 10/19 (53%)
C2H2 Zn finger 565..582 CDD:275368 4/16 (25%)
LOC108348302XP_017455832.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.