DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and Gm6871

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001365582.1 Gene:Gm6871 / 102642386 MGIID:3643456 Length:438 Species:Mus musculus


Alignment Length:400 Identity:113/400 - (28%)
Similarity:175/400 - (43%) Gaps:74/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 RPQENYQLQQLLLEH----INASHDP-EQPYNCPECEARFQDAASRTVHLKSSHVEKQHACGVCG 253
            :|.|.:|..:.|..|    |:...|. ::||.|.:|:..|........|.::...:|.:.|..||
Mouse   101 KPSEGFQHIEALACHSSLQIHKRTDTGKKPYKCNQCDKVFSQQRHLRTHERTHTGKKPYECDQCG 165

  Fly   254 KKYGDRHNLRHHVEKYHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQR 318
            |.:..:..|..|...:..|..:||..|.|.|....::..|.:.|..::.::|  ..|.:.|..|.
Mouse   166 KAFAYQSALVLHKRTHTGEKPYECDQCGKAFAHHFTVVLHKRTHTGEKPYEC--DQCGKAFAYQS 228

  Fly   319 HLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIH 383
            .|:.|:.||:|   .|...|..|||||..:..||.|.. .|.|||||||..|.:.|:..:..|||
Mouse   229 ALVLHKRTHTG---EKPYECNQCGKTFAQINHLRTHKV-VHTGEKPYKCNQCDKAFSQQSHLRIH 289

  Fly   384 MLERHRENLTAIERSECMLCRQPFSSEPDLIHHMSAEHLQRPGAPIIANNKRVLQQKRERQYSG- 447
                                                                      ||.::| 
Mouse   290 ----------------------------------------------------------ERTHTGE 296

  Fly   448 -LFQCGSCSQRFNMKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVC 511
             .::|..|.:.|...|.|:.|..:|: .::|:.|..|.|.|.:...::.|.:||..|||..|:.|
Mouse   297 KPYKCNQCGKSFVSHSHLQSHGRIHT-GEKPYKCNQCDKAFAQHNSLQIHKRTHTGEKPYKCNQC 360

  Fly   512 GKAFALKYVLTQHRLSHEVLEKNFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDLCQERFVTHI 576
            .||||....|..|:.:| ..||.::|:.||:|:....::.||:|||||:..|:||.|.:.|..|.
Mouse   361 DKAFAQSSSLQYHKRTH-TGEKPYECDQCGKAFTHPSTVVLHKRTHTGEKPYECDQCGKAFAHHS 424

  Fly   577 KLKTHMQKAH 586
            .|:.| :|.|
Mouse   425 TLQYH-KKNH 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 79/316 (25%)
C2H2 Zn finger 221..241 CDD:275368 4/19 (21%)
C2H2 Zn finger 249..269 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 5/19 (26%)
C2H2 Zn finger 305..327 CDD:275368 6/21 (29%)
C2H2 Zn finger 338..359 CDD:275368 9/20 (45%)
C2H2 Zn finger 367..384 CDD:275368 5/16 (31%)
C2H2 Zn finger 400..420 CDD:275368 0/19 (0%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 5/19 (26%)
C2H2 Zn finger 508..528 CDD:275368 8/19 (42%)
C2H2 Zn finger 537..557 CDD:275368 7/19 (37%)
C2H2 Zn finger 565..582 CDD:275368 6/16 (38%)
Gm6871NP_001365582.1 KRAB 4..44 CDD:396083
C2H2 Zn finger 133..153 CDD:275368 4/19 (21%)
zf-H2C2_2 145..170 CDD:404364 6/24 (25%)
C2H2 Zn finger 161..181 CDD:275368 6/19 (32%)
zf-H2C2_2 173..198 CDD:404364 8/24 (33%)
C2H2 Zn finger 189..209 CDD:275368 5/19 (26%)
zf-H2C2_2 205..226 CDD:404364 5/22 (23%)
C2H2 Zn finger 217..237 CDD:275368 6/21 (29%)
COG5048 <241..421 CDD:227381 70/240 (29%)
C2H2 Zn finger 245..265 CDD:275368 9/20 (45%)
C2H2 Zn finger 273..293 CDD:275368 8/77 (10%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
C2H2 Zn finger 413..433 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.