DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8301 and LOC102547287

DIOPT Version :9

Sequence 1:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_006227880.2 Gene:LOC102547287 / 102547287 RGDID:7718701 Length:549 Species:Rattus norvegicus


Alignment Length:472 Identity:133/472 - (28%)
Similarity:210/472 - (44%) Gaps:68/472 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EEVEEPITDESAPPQLTI-----SYACKFCLRPQENYQLQQLLLEHINASHDPEQPYNCPECEAR 227
            |:.:|| :....||..|:     .|.|:   ...:.:....||::| ...|..|:||.|.||...
  Rat    67 EQRQEP-SVVKRPPAATMHPGGKPYKCQ---EFDKAFDWNSLLIQH-RRIHPVEKPYKCEECGKV 126

  Fly   228 FQDAASRTVHLKSSHVEKQHACGVCGKKYGDRHNLRHHVEKYHSETDFECALCEKRFYTRKSLNY 292
            |...::.::|.:....||.:.|..|||.:..|..|..|.:.:..|..::|..|.|.||....|..
  Rat   127 FSAHSALSIHQRIHTGEKPYKCEECGKAFSTRSALYIHKKIHSGEKPYKCEECAKAFYFPSLLKQ 191

  Fly   293 HMKWHNPDRQFKCRHSGCERLFISQRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIYR 357
            |.:.|:.:...||..  |.:.|.....|..|:..||..:..:   |..|||.|.:..||:.| .|
  Rat   192 HQRTHSAENLCKCEE--CGKAFYLPSFLKQHQRIHSAENPYR---CEECGKAFSYPSTLKQH-QR 250

  Fly   358 QHGGEKPYKCANCTEVFAS----YAEKRIHMLER------------HRENL-------TAIERSE 399
            .|.|||||:|..|.:.|..    :..:|||..|:            :|.||       :.::..:
  Rat   251 IHSGEKPYRCEECGKAFRRSTYFHQHQRIHTGEKPYQCEECGKTFYYRSNLKGHQIIHSGVKPYK 315

  Fly   400 CMLCRQPFSSEPDLIHHMSAEHLQRPGAPI-----------IANNKRVLQQK----RERQYSGLF 449
            |.:|...|.:..||..|      ||..|.:           .:.:..:::.|    ||:.|    
  Rat   316 CDVCGSMFRTSSDLSKH------QRIHAEVKLYSCEECGKAFSTHSYLIRHKLGHSREKPY---- 370

  Fly   450 QCGSCSQRFNMKSALERHAAVHSEKDRPHACPHCSKRFKRAQDMKWHIKTHEKEKPNVCDVCGKA 514
            :|..|.:.|...|.|:.|..:||.. :|:.|..|...|:...::..|.:.|.:.|...|:.||||
  Rat   371 KCEECGKTFCYPSILKEHQRIHSGV-KPYNCDICGSMFRTRSELSKHQRIHAEVKLYSCEECGKA 434

  Fly   515 FALKYVLTQHRLSHEVLEKNFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDLCQERFVTHIKLK 579
            |:....|.:|||.|.. ||.:||..||::|.:...|:.|||.|: :..||||:|.:.|.|.....
  Rat   435 FSTHSYLMRHRLGHSG-EKPYKCEECGKSYSYPSLLKEHQRIHS-QNPYKCDICGKVFCTRSGRS 497

  Fly   580 THMQKAHAASQPHSADQ 596
            .| |:.|...:|:..::
  Rat   498 KH-QRIHTGEKPYKCEE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 91/347 (26%)
C2H2 Zn finger 221..241 CDD:275368 5/19 (26%)
C2H2 Zn finger 249..269 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..297 CDD:275368 7/19 (37%)
C2H2 Zn finger 305..327 CDD:275368 5/21 (24%)
C2H2 Zn finger 338..359 CDD:275368 9/20 (45%)
C2H2 Zn finger 367..384 CDD:275368 5/20 (25%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 480..500 CDD:275368 4/19 (21%)
C2H2 Zn finger 508..528 CDD:275368 10/19 (53%)
C2H2 Zn finger 537..557 CDD:275368 8/19 (42%)
C2H2 Zn finger 565..582 CDD:275368 5/16 (31%)
LOC102547287XP_006227880.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24377
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.