DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8301 and ube2c

DIOPT Version :9

Sequence 1:	NP_649915.1	Gene:	CG8301 / 41160	FlyBaseID:	FBgn0037717	Length:	607	Species:	Drosophila melanogaster
Sequence 2:	NP_001095283.1	Gene:	ube2c / 100124324	XenbaseID:	XB-GENE-971108	Length:	179	Species:	Xenopus tropicalis

Alignment Length:	151	Identity:	29/151 - (19%)
Similarity:	44/151 - (29%)	Gaps:	59/151 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 LDLHHPNCWPSEMAQIRLQFANWNLKISPNDGLPQKICSDCFTKFCSINAFRLACQEAQLKLSHI 90
            |.|..|:.:|.....::.....::    ||......||.|....                |.|.:
Frog    81 LSLEFPSGYPYNAPTVKFVTPCFH----PNVDSHGNICLDILKD----------------KWSAL 125

  Fly    91 YD----KIDASSLEDDEIGQEDLEPAEEHQETETTKPTTTVSAETQPNNTASDPIEIFVDAVDID 151
            ||    .:...||    :|    ||..|       .|....:||...|.||
Frog   126 YDVRTILLSLQSL----LG----EPNNE-------SPLNPYAAELWQNQTA-------------- 161

  Fly   152 EAEEEEEEEEQQQQYDEEVEE 172
                  .::...:||.::|.|
Frog   162 ------YKKHLHEQYQKQVRE 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8301	NP_649915.1	zf-AD	3..87	CDD:285071	9/60 (15%)
		COG5048	198..>508	CDD:227381
		C2H2 Zn finger	221..241	CDD:275368
		C2H2 Zn finger	249..269	CDD:275368
		C2H2 Zn finger	277..297	CDD:275368
		C2H2 Zn finger	305..327	CDD:275368
		C2H2 Zn finger	338..359	CDD:275368
		C2H2 Zn finger	367..384	CDD:275368
		C2H2 Zn finger	400..420	CDD:275368
		C2H2 Zn finger	451..471	CDD:275368
		C2H2 Zn finger	480..500	CDD:275368
		C2H2 Zn finger	508..528	CDD:275368
		C2H2 Zn finger	537..557	CDD:275368
		C2H2 Zn finger	565..582	CDD:275368
ube2c	NP_001095283.1	UQ_con	34..170	CDD:365926	25/143 (17%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910