DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Son and GPATCH2

DIOPT Version :9

Sequence 1:NP_001262426.1 Gene:Son / 41159 FlyBaseID:FBgn0037716 Length:874 Species:Drosophila melanogaster
Sequence 2:XP_011507991.1 Gene:GPATCH2 / 55105 HGNCID:25499 Length:551 Species:Homo sapiens


Alignment Length:598 Identity:114/598 - (19%)
Similarity:198/598 - (33%) Gaps:206/598 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KEKSESRKRSAVEPSSHS---------EKRERHEREK-----HRDWE--------REREREKEHE 272
            :|.||..:....|...||         :.|:|..|::     |..||        .:...|:..:
Human    37 EESSEQARGGFAETGDHSRSISCPLKRQARKRRGRKRRSYNVHHPWETGHCLSEGSDSSLEEPSK 101

  Fly   273 RERVRSNNSFYNGQREADRLKGSESASTKSRQEQDLSDISLSDEESYL--REKASN------GRR 329
            ..|...||:                       ::|.||   ||::..:  |..:||      |:|
Human   102 DYRENHNNN-----------------------KKDHSD---SDDQMLVAKRRPSSNLNNNVRGKR 140

  Fly   330 RA-HNSFY--DEKEELSVSPKRNVRE---------SNTRRNRKSRSRSRDLGIDKKRLLEI---- 378
            .. |.|.:  |.....::..:|.|:.         ||.|...:.....||..:|..|..:.    
Human   141 PLWHESDFAVDNVGNRTLRRRRKVKRMAVDLPQDISNKRTMTQPPEGCRDQDMDSDRAYQYQEFT 205

  Fly   379 ---ARRNAINMFKQGTMPGVANMTAEVKDK-VLVKMRYGGRTIQDLTDFC--KKISNGDGLSDLS 437
               .::..:.:.:||         .:::|: |:::.....:|.:|..: |  :|:|:     :|.
Human   206 KNKVKKRKLKIIRQG---------PKIQDEGVVLESEETNQTNKDKME-CEEQKVSD-----ELM 255

  Fly   438 SEEESDVDKNGNAKVFHHP------------FQLKEREPIVMHIRNSTALVP-----APPRLDEQ 485
            ||.:|....:.:|.:|.:.            |..||.....    ..|.:||     .|..||:.
Human   256 SESDSSSLSSTDAGLFTNDEGRQGDDEQSDWFYEKESGGAC----GITGVVPWWEKEDPTELDKN 316

  Fly   486 T------KAITMQFPVSSGQTHRNNEVWVPVDPKDSLVPLPSLPPAKQATNMFKETPKNVFAKSI 544
            .      ..:|..||:.|..:.|..:.                    :.:.:...:.||:     
Human   317 VPDPVFESILTGSFPLMSHPSRRGFQA--------------------RLSRLHGMSSKNI----- 356

  Fly   545 PLQEQQEPAFKPLGGAVVVPPLAATQLPTVPQSVPPTVPKEFAPPAVPFVPEVPIPSTSPVTPMQ 609
                      |..||              .|.|:                  ||||  .||...:
Human   357 ----------KKSGG--------------TPTSM------------------VPIP--GPVGNKR 377

  Fly   610 SASIFPDVTPPSMDVSSIITQRLSAIRRLQENPADSEALK--MMYTAQRNMSSWANS-------- 664
            .....||........|..........:.|::|.|:....|  .:.||.|..|....|        
Human   378 MVHFSPDSHHHDHWFSPGARTEHDQHQLLRDNRAERGHKKNCSVRTASRQTSMHLGSLCTGDIKR 442

  Fly   665 ----KHLPGQFTGSTGAQVM-KAHELNSGPQLWVRKDQM-TSTKPV-TGGMGMALLQKMGWKPGE 722
                ..|||..|..|.:.:: :.|.::...|::.:...: .:.:|: ...:|..:||.|||.||.
Human   443 RRKAAPLPGPTTAGTCSHILDETHVISLAIQIFHKAGFVGENAQPILENNIGNRMLQNMGWTPGS 507

  Fly   723 GLGRCKTGSLQPL 735
            ||||...|..:|:
Human   508 GLGRDGKGISEPI 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SonNP_001262426.1 PHA03247 <455..627 CDD:223021 30/194 (15%)
G-patch 705..747 CDD:396249 14/31 (45%)
DSRM_SON-like 798..872 CDD:380699
GPATCH2XP_011507991.1 G-patch 491..534 CDD:279867 14/30 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4438
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.