DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Son and SPCC1442.13c

DIOPT Version :9

Sequence 1:NP_001262426.1 Gene:Son / 41159 FlyBaseID:FBgn0037716 Length:874 Species:Drosophila melanogaster
Sequence 2:NP_588327.3 Gene:SPCC1442.13c / 2539327 PomBaseID:SPCC1442.13c Length:187 Species:Schizosaccharomyces pombe


Alignment Length:165 Identity:39/165 - (23%)
Similarity:64/165 - (38%) Gaps:21/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 SPVTPMQSASIFPDVTPPSMDVSS---------IITQRLSAIR-RLQENPADSEALKMMYTAQRN 657
            ||..|.:...|......||..:|:         :..:|...:. ....:.|:.|....|....|:
pombe    22 SPKPPPRKPKIVQPKKKPSKHLSNEDALEKYEMLFGERRKEVELDYMSHIAEEETSLSMIEYDRH 86

  Fly   658 MSSWAN---SKHLPGQFTGST--GAQVMKAHELNSGPQLWVRKDQM------TSTKPVTGGMGMA 711
            .:...:   ||....:....|  |.:..|..::..|......|.:|      :|...:..|.|..
pombe    87 FALQTDVKLSKKRKSKLVEMTPKGLKKRKRVQIQEGSVSTNTKKRMDGHVVGSSAPAINNGKGKQ 151

  Fly   712 LLQKMGWKPGEGLGRCKTGSLQPLLLDVKLDKRGL 746
            ||:.|||..|:|||....|.:.|::..||.:|:||
pombe   152 LLEMMGWSRGKGLGSENQGMVDPVVAVVKNNKQGL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SonNP_001262426.1 PHA03247 <455..627 CDD:223021 7/32 (22%)
G-patch 705..747 CDD:396249 18/42 (43%)
DSRM_SON-like 798..872 CDD:380699
SPCC1442.13cNP_588327.3 G_patch 145..186 CDD:197727 16/40 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4438
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.